PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 47586
Common NameMICPUCDRAFT_47586
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas; Micromonas pusilla
Family SBP
Protein Properties Length: 494aa    MW: 49089 Da    PI: 5.4938
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
47586genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP64.52.3e-20129202277
            -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
    SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
            C ++gC++   +   y rr++ C+ h  +  vl +gl+qrfCq+Cs fh+l  fD ++++Cr+ L+ +ne rrk +
  47586 129 CTADGCDKACDT--AYTRRYRTCREHIDSLDVLRDGLHQRFCQRCSSFHALAAFDGSRHTCRQALDAYNESRRKIR 202
            889999887665..6**********************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114118.674126201IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-17128202IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.4E-16128188IPR004333Transcription factor, SBP-box
PfamPF031104.1E-22129200IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0042127Biological Processregulation of cell proliferation
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MSTEGDEDFD ARIDAEFDRA RKEHSEEAVK RKRGDLGSES SDLERQKFDS GKSNSTSLDP  60
EGGIDARDDA PASARPTTTT TTTTHTQTAP EATTETTETE TPDADADANA AARTELARVH  120
PRAQITCPCT ADGCDKACDT AYTRRYRTCR EHIDSLDVLR DGLHQRFCQR CSSFHALAAF  180
DGSRHTCRQA LDAYNESRRK IRKAAKEKKN LEAAGGAAAA AIAAATAAAT ANARDAAAAA  240
GLLGGLFDAT ARAALEAGAG PGVARPGAAG AAGLLGGVAG LAGLGGWGGL SGVGLSGLGG  300
IGGFGFGLSG VGGVGGVGGG ATAPPADATA TEALLLRLRL RQAAASNSLA ELARARAVAV  360
AAGADPNGQN LAALTAGAAA SDSPRADLVA AYLNASARPE AAPAPAPAPA SDLGLALHRA  420
AALRAAQSHA TIDPAVAAYA SELQWQLASA RETQMATQME TQMELQAAAG AAGTAATGAG  480
AGAGAGADGA GGR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00412DAPTransfer from AT3G57920Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003059595.10.0predicted protein
TrEMBLC1MV150.0C1MV15_MICPC; Predicted protein
STRINGXP_003059595.10.0(Micromonas pusilla)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.16e-13squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Worden AZ, et al.
    Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas.
    Science, 2009. 324(5924): p. 268-72
    [PMID:19359590]