PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 39571
Common NameMICPUCDRAFT_39571
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas; Micromonas pusilla
Family Nin-like
Protein Properties Length: 1238aa    MW: 126923 Da    PI: 6.3407
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
39571genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK74.99.6e-24636684351
  RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51 
             + ++le l+++Fs+++k+AAk+Lgv+ T+LKriCR+yGI RWP+R +ks
   39571 636 WGVTLEILQQHFSKHLKQAAKDLGVGSTTLKRICRRYGITRWPRRSLKS 684
             5689*******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.392619705IPR003035RWP-RK domain
PfamPF020424.0E-21638684IPR003035RWP-RK domain
PROSITE profilePS501949.465708756IPR017868Filamin/ABP280 repeat-like
PROSITE profilePS5174511.1589921082IPR000270PB1 domain
SMARTSM006663.510071086IPR000270PB1 domain
CDDcd059928.35E-610101078No hitNo description
Gene3DG3DSA:3.10.20.2401.7E-710421080No hitNo description
PfamPF005642.4E-510451076IPR000270PB1 domain
SuperFamilySSF542774.58E-810451078No hitNo description
SuperFamilySSF542773.92E-611411219No hitNo description
Gene3DG3DSA:3.10.20.2403.1E-611411215No hitNo description
SMARTSM006660.05211431228IPR000270PB1 domain
PROSITE profilePS5174511.21211431226IPR000270PB1 domain
PfamPF005646.1E-511441222IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1238 aa     Download sequence    Send to blast
MPRKSAAAAP PPPSPADDVA NEPDLADFLK QLVNVDDVGV GDAGGDRFLH PRGAANADAV  60
WSDLDNLDVA DPIYMSLGAG GGALGALAAA DHVRERVVDS PSPASVAGAN GRGERDTRKE  120
VAENRRDSNS PASVGGEPTG SGGRGGSGGP GSSAASAVKT FEHLGETLRV LSDQLRAARR  180
PHESVPEVGG ADRTAEATQR RLASTLDDIS ERLDVGSLVQ LFVPKLQSRT GGALVMLQTF  240
KAFTRVKTVH REKFWKYHRM SEGFFFNLSP GGDSNLLGLP GRCFLHSRPE WTPSVCCYQP  300
TEYPRLGCAI DCQMHSTIAL PVYFDDPRVR PAMPFAVMEL LLDQQVTDMG RVFDTCVGAL  360
RGNGLYTAGT DRLGTEDTMR AALGSKLSRV GEGNDVALEN MCHALGFPLA QCWIPNDDGL  420
LIAAGAPYCV KDAMAFPFRQ ISSQISLLGG QGPVGQVYEQ GTMIWVDDVQ NGSQVDWPLQ  480
HATALLGLHG ACTCKIVLHQ KHPRGGGGGA AGEPIEAVLE VILPSNLLIA EQQRRSVDAL  540
WNYLQNSTEL RLVTGGASAA TRAASQAQAA RGGGAKATAN ANAARGGAEL NSRSSDLTAA  600
VGGDGDGAGG RAHGGNLLAG IPLPGDANAE ENVPTWGVTL EILQQHFSKH LKQAAKDLGV  660
GSTTLKRICR RYGITRWPRR SLKSKQGKLQ QVLKSLYTGD GAAEASPQGG GDASLARASG  720
GGGESAMSLG TRDSFMTDPT SGGDGANDAS VHGPSGGGGW GVGVGGSLPH GGGLSPLTRH  780
DSITSSPLSG RPACPPVGGL AGGHNLSGLK RALAADQNPW GGGGVGMPRP GNAGGRPGGD  840
GDGVGVGKFQ RGFSWHGGDV ARRALHNDAE TRGEWTLHGE LTFAQLGGGP GRAGYPEQGA  900
AAHPSSAWPI PGASHDRGGH HGGAGPTNED LKDAADADAD TAGARARATA AGPSGGTTTS  960
DDGGGSSFDA DSSGKTSLLS PSECAAAAGG AGVVFKASIC GDGDGGGGLL RARLLGDVTR  1020
AALVDRLALC LRPRDPAEPG AGEKPGFKIK YQDDEDEWCL LSKDSDLEEA IAFAKQRRER  1080
AAASGTAADL ATALGHVRLK IEGASPSPTA AASALDRRAD DVPARGGGTP LSAARACGAS  1140
DTTFTAKISL GDGDTMRVKL VPGMSFRDLA SVVTEASGGA AARRPATPTL TYTDDADESC  1200
DLRGDADLDE CRAACARSGT IRVRATFGGG GDQRLRV*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003058325.10.0nit2-like protein 2
TrEMBLC1MRL00.0C1MRL0_MICPC; Nit2-like protein 2
STRINGXP_003058325.10.0(Micromonas pusilla)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP547469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.12e-26Nin-like family protein
Publications ? help Back to Top
  1. Worden AZ, et al.
    Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas.
    Science, 2009. 324(5924): p. 268-72
    [PMID:19359590]