PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 21861 | ||||||||
Common Name | MICPUCDRAFT_21861 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas; Micromonas pusilla
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 169aa MW: 18944.8 Da PI: 11.4773 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 81.4 | 5.9e-26 | 42 | 92 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +ri +++nrqvtf+kR+ng++KKA ELSvLCd ++a++if s++kl+ yss 21861 42 ERIADERNRQVTFTKRKNGLMKKAMELSVLCDCQIALVIFNSNNKLFQYSS 92 699**********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.8E-32 | 34 | 93 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 27.964 | 34 | 94 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.31E-29 | 35 | 105 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.25E-35 | 35 | 106 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 36 | 90 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-25 | 36 | 56 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.2E-25 | 43 | 90 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-25 | 56 | 71 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-25 | 71 | 92 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009553 | Biological Process | embryo sac development | ||||
GO:0010094 | Biological Process | specification of carpel identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048366 | Biological Process | leaf development | ||||
GO:0048455 | Biological Process | stamen formation | ||||
GO:0048459 | Biological Process | floral whorl structural organization | ||||
GO:0048497 | Biological Process | maintenance of floral organ identity | ||||
GO:0048509 | Biological Process | regulation of meristem development | ||||
GO:0048833 | Biological Process | specification of floral organ number | ||||
GO:0080060 | Biological Process | integument development | ||||
GO:0080112 | Biological Process | seed growth | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 169 aa Download sequence Send to blast |
MLDRRSLPPP RPRPLVFPPL TRDPTPYRPV AAAVGRKKIR IERIADERNR QVTFTKRKNG 60 LMKKAMELSV LCDCQIALVI FNSNNKLFQY SSGDINHVLT RFKNDTVGPH ERRNNKDVRE 120 RANARAGVDF SSSFSFGPFS VFTDAFSSPL AVGLPSLATR TPSITHHI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 1e-36 | 35 | 125 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3kov_B | 1e-36 | 35 | 125 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3kov_I | 1e-36 | 35 | 125 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3kov_J | 1e-36 | 35 | 125 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3p57_A | 1e-36 | 35 | 125 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3p57_B | 1e-36 | 35 | 125 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3p57_C | 1e-36 | 35 | 125 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3p57_D | 1e-36 | 35 | 125 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3p57_I | 1e-36 | 35 | 125 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3p57_J | 1e-36 | 35 | 125 | 1 | 90 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003063080.1 | 1e-120 | predicted protein | ||||
Swissprot | A2VDZ3 | 1e-33 | MEF2A_BOVIN; Myocyte-specific enhancer factor 2A | ||||
TrEMBL | C1N4Z2 | 1e-119 | C1N4Z2_MICPC; Predicted protein | ||||
STRING | XP_003063080.1 | 1e-119 | (Micromonas pusilla) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP3656 | 13 | 14 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G42830.1 | 7e-23 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 21861 |
Entrez Gene | 9688520 |
Publications ? help Back to Top | |||
---|---|---|---|
|