PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 20274 | ||||||||
Common Name | MICPUCDRAFT_20274, NFYB | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas; Micromonas pusilla
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 140aa MW: 15534.3 Da PI: 4.5348 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 188.7 | 4e-59 | 23 | 119 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 vreqdrflPian+srimkk+lPanaki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa++tlGfe+yveplkvyl+kyre+egek 20274 23 VREQDRFLPIANISRIMKKALPANAKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMSTLGFEEYVEPLKVYLHKYRETEGEK 119 69********************************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 9.5E-58 | 18 | 129 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.81E-42 | 26 | 128 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.0E-28 | 29 | 93 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 7.8E-23 | 57 | 75 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 60 | 76 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 7.8E-23 | 76 | 94 | No hit | No description |
PRINTS | PR00615 | 7.8E-23 | 95 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 140 aa Download sequence Send to blast |
MSAEKEPEYG GGDDDDDERG ENVREQDRFL PIANISRIMK KALPANAKIA KDAKETVQEC 60 VSEFISFITS EASDKCQREK RKTINGDDLL WAMSTLGFEE YVEPLKVYLH KYRETEGEKA 120 EKSKAGANPS NAAQGDLLS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 1e-48 | 22 | 114 | 5 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003061751.1 | 2e-99 | histone-like transcription factor | ||||
Swissprot | Q75IZ7 | 1e-63 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | C1N154 | 5e-98 | C1N154_MICPC; Histone-like transcription factor | ||||
STRING | XP_003061751.1 | 8e-99 | (Micromonas pusilla) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP2023 | 16 | 16 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 8e-66 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 20274 |
Entrez Gene | 9686950 |
Publications ? help Back to Top | |||
---|---|---|---|
|