PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 16466 | ||||||||
Common Name | MICPUCDRAFT_16466 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas; Micromonas pusilla
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 112aa MW: 12616 Da PI: 10.0471 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 41.1 | 3.8e-13 | 43 | 106 | 1 | 64 |
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC CS bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkseve 64 ++++k +rrk+ NRe+Arrs qRKk+e e L k++eL +e +L+ +le+ +k+++kl +e++ 16466 43 DRDVKTQRRKEANRESARRSKQRKKEESELLSSKAQELVKESVSLRAKLEKVQKQADKLYAENM 106 5899*******************************************************99886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 6.8E-9 | 43 | 101 | No hit | No description |
SMART | SM00338 | 2.0E-10 | 43 | 107 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 3.2E-11 | 44 | 106 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.634 | 45 | 108 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.56E-8 | 47 | 102 | No hit | No description |
CDD | cd14702 | 6.50E-10 | 49 | 99 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 112 aa Download sequence Send to blast |
MGAYNNVSGS QPYWYTHGAY PEGANGAGVN GGTSNEVSIA LRDRDVKTQR RKEANRESAR 60 RSKQRKKEES ELLSSKAQEL VKESVSLRAK LEKVQKQADK LYAENMELRE QV |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 59 | 65 | RRSKQRK |
2 | 59 | 67 | RRSKQRKKE |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003058061.1 | 4e-76 | predicted protein, partial | ||||
TrEMBL | C1MQ43 | 9e-75 | C1MQ43_MICPC; Predicted protein (Fragment) | ||||
STRING | XP_003058061.1 | 2e-75 | (Micromonas pusilla) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP9223 | 4 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G32150.1 | 3e-16 | basic region/leucine zipper transcription factor 68 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 16466 |
Entrez Gene | 9683005 |
Publications ? help Back to Top | |||
---|---|---|---|
|