PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly1350s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family GRF
Protein Properties Length: 789aa    MW: 83371.9 Da    PI: 8.8248
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly1350s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC789.3e-25280323144
                  WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                          d+epgrCrRtDGKkWRCsr+v++++k+CErH+hrgr+rsrk+ +
  Mapoly1350s0001.1.p 280 DPEPGRCRRTDGKKWRCSRDVVPDQKYCERHMHRGRHRSRKPTD 323
                          79***************************************876 PP

2QLQ50.94.6e-18213248237
                  QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                          +FT  Q+++L++Q+l++Ky++a++ vPp+Ll +i+k
  Mapoly1350s0001.1.p 213 PFTTGQWAELEHQALIFKYMMAGVNVPPDLLNPIRK 248
                          9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.5E-9212248IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.13213248IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.0E-13213247IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166726.138280324IPR014977WRC domain
PfamPF088795.8E-21281321IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 789 aa     Download sequence    Send to blast
MDFSHSSAAA TAGLTSSALG FGERPLSSLS SDLTDNHHRS RMPSHHNMPP TSVGSMSPGL  60
NPLKQCRSEM DLDGRGGGDD RRGPLKLART DSFSCRQSDL KMHMSSGSPG ASLVRSNSVV  120
SDGRLGCSPT NSCASDGALL GSDATVVSDS RQLMRSDSVV SAPAYPGAQQ PGRSPLSYHH  180
QSYHYKPAGN SLNMGREGVG HMSMQNISSA RAPFTTGQWA ELEHQALIFK YMMAGVNVPP  240
DLLNPIRKSV AAMNGLTPAS HHATNMGWGT FHLGVASNAD PEPGRCRRTD GKKWRCSRDV  300
VPDQKYCERH MHRGRHRSRK PTDGQATSTS PAATASSAAA NSSSVTTNRS VPGSGGSSLG  360
HSNLSPTISA SSQHGGGQQQ QQQQQQQQQQ QQQQHQSLGM KSFGSNHSGS GAGGISIGTS  420
GTSNSSGSQF QLPLQSASGA SALGNKDYRY LNGMNKSDLG MGPEQMLFSE TSGSARGLGQ  480
DSPSMSNLSR LSSVNHSWQA LSSKVPPAPQ PKSGNSSSLL HYTTPQMRTL LGGQDFGLMP  540
ETSQVNISMQ QQQQHSFLSN GYGAVEAVSV VREPEGQPLR HFFDDWPRPR DPSALSWSDV  600
EEERSNRSNG STTQLSISIP VTSSDFPTSN ASPPRGKLSL SPLKLSMSRA GEEDHLGTDP  660
THMGLGVGMG LGMNEDRHRQ PPWIPITWET PVGGPLAEVL QSSTPRGGGK SSCLNLLCDG  720
WDSSPRDSPR MASPTGVLQK ATFGSFSDSS SSGSSPRTIK SEPNGGITCE QNLRSSSVLV  780
TGSSHLSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024400506.10.0growth-regulating factor 6-like isoform X1
RefseqXP_024400507.10.0growth-regulating factor 6-like isoform X1
TrEMBLA0A2R6VY150.0A0A2R6VY15_MARPO; Uncharacterized protein
STRINGPP1S344_39V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-45growth-regulating factor 2