PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Mapoly0330s0001.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 300aa MW: 34317.6 Da PI: 5.7806 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.7 | 1.1e-17 | 58 | 102 | 3 | 48 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +WT+eEde l av+++ g++Wk Ia+ + +R++ qc +rwqk+l Mapoly0330s0001.1.p 58 SWTAEEDETLRAAVEKFKGRNWKQIAANLR-NRSDAQCLHRWQKVL 102 7*****************************.************986 PP | |||||||
2 | Myb_DNA-binding | 56.9 | 4.8e-18 | 108 | 154 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEd++ +++vk +G+++W++Iar m+ gR kqc++rw ++l Mapoly0330s0001.1.p 108 KGYWSKEEDDKMLELVKTFGTKRWAAIARAMP-GRNSKQCRERWCNHL 154 689*****************************.*************96 PP | |||||||
3 | Myb_DNA-binding | 53.7 | 4.7e-17 | 160 | 203 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 + +W++eEd lv a+++lG++ W+ Ia+ ++ gR+++ +k+rw++ Mapoly0330s0001.1.p 160 KEPWSEEEDMMLVMAHQRLGNR-WAEIAKIIP-GRSDNAIKNRWNT 203 679*******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.828 | 51 | 102 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.18E-15 | 51 | 107 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.7E-15 | 55 | 104 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.2E-22 | 57 | 118 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.22E-12 | 58 | 102 | No hit | No description |
Pfam | PF00249 | 2.9E-15 | 58 | 102 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 27.719 | 103 | 158 | IPR017930 | Myb domain |
SMART | SM00717 | 6.4E-17 | 107 | 156 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.77E-32 | 107 | 201 | IPR009057 | Homeodomain-like |
Pfam | PF13921 | 2.2E-19 | 111 | 171 | No hit | No description |
CDD | cd00167 | 3.97E-14 | 111 | 154 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.8E-27 | 119 | 161 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.2E-16 | 159 | 207 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.941 | 159 | 209 | IPR017930 | Myb domain |
CDD | cd00167 | 1.33E-11 | 162 | 203 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 9.5E-23 | 162 | 207 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 300 aa Download sequence Send to blast |
MEGSSTLPKL PQRRCLEEII NSSEDNLPSA AVVDFPLDRK GKKIRVYHAP QPRKPSTSWT 60 AEEDETLRAA VEKFKGRNWK QIAANLRNRS DAQCLHRWQK VLNPILVKGY WSKEEDDKML 120 ELVKTFGTKR WAAIARAMPG RNSKQCRERW CNHLDPKIKK EPWSEEEDMM LVMAHQRLGN 180 RWAEIAKIIP GRSDNAIKNR WNTAKNKRSD ALEQSSENWI NSSTFGDMCS FTEDVAQTDL 240 DANQHVLAWN GEPNVVTWNG ESNIDIQDSN AAEDLALNSV FGPDKIEDED CFPDFDFCL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 3e-61 | 56 | 208 | 6 | 158 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 3e-61 | 56 | 208 | 6 | 158 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in abiotic stress responses (PubMed:17293435, PubMed:19279197). May play a regulatory role in tolerance to salt, cold, and drought stresses (PubMed:17293435). Transcriptional activator that binds specifically to a mitosis-specific activator cis-element 5'-(T/C)C(T/C)AACGG(T/C)(T/C)A-3', found in promoters of cyclin genes such as CYCB1-1 and KNOLLE (AC Q84R43). Positively regulates a subset of G2/M phase-specific genes, including CYCB1-1, CYCB2-1, CYCB2-2, and CDC20.1 in response to cold treatment (PubMed:19279197). {ECO:0000269|PubMed:17293435, ECO:0000269|PubMed:19279197}. | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (PubMed:21862669). Involved in the regulation of cytokinesis, probably via the activation of several G2/M phase-specific genes transcription (e.g. KNOLLE) (PubMed:17287251, PubMed:21862669, PubMed:25806785). Required for the maintenance of diploidy (PubMed:21862669). {ECO:0000269|PubMed:17287251, ECO:0000269|PubMed:21862669, ECO:0000269|PubMed:25806785}.; FUNCTION: Involved in transcription regulation during induced endoreduplication at the powdery mildew (e.g. G.orontii) infection site, thus promoting G.orontii growth and reproduction. {ECO:0000269|PubMed:20018666}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by cold, drought and salt stresses. {ECO:0000269|PubMed:17293435}. | |||||
UniProt | INDUCTION: Slightly induced by salicylic acid (SA) (PubMed:16463103). Expressed in a cell cycle-dependent manner, with highest levels 2 hours before the peak of mitotic index in cells synchronized by aphidicolin. Activated by CYCB1 (PubMed:17287251). Accumulates at powdery mildew (e.g. G.orontii) infected cells. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:17287251}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028210650.1 | 4e-66 | transcription factor MYB3R-1-like | ||||
Refseq | XP_028210652.1 | 4e-66 | transcription factor MYB3R-1-like | ||||
Refseq | XP_028210653.1 | 4e-66 | transcription factor MYB3R-1-like | ||||
Swissprot | Q0JHU7 | 3e-64 | MB3R2_ORYSJ; Transcription factor MYB3R-2 | ||||
Swissprot | Q94FL9 | 1e-63 | MB3R4_ARATH; Transcription factor MYB3R-4 | ||||
TrEMBL | A0A2R6VYZ3 | 0.0 | A0A2R6VYZ3_MARPO; Uncharacterized protein | ||||
STRING | GLYMA17G26240.2 | 1e-65 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G11510.2 | 1e-66 | myb domain protein 3r-4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Mapoly0330s0001.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|