PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Mapoly0132s0031.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 221aa MW: 25862.8 Da PI: 9.6421 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.3 | 3.2e-17 | 32 | 76 | 3 | 48 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rWT+eEdell +av q+ ++W+++a+ ++ +Rt+ qc rwqk+l Mapoly0132s0031.1.p 32 RWTPEEDELLQEAVVQYKAKNWRLVAKAVP-NRTEIQCLQRWQKVL 76 9*****************************.************986 PP | |||||||
2 | Myb_DNA-binding | 55.5 | 1.3e-17 | 82 | 127 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g WT+eEd++ +++v +lG+++W+++ar ++ gR +kqc++rw++ Mapoly0132s0031.1.p 82 KGYWTKEEDQKMLELVGMLGTKRWAAVARSLP-GRIGKQCRERWYNQ 127 789*****************************.************96 PP | |||||||
3 | Myb_DNA-binding | 42.7 | 1.3e-13 | 134 | 178 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r++WT+ Ed +l a+k++G++ W+ I + ++ gR+++ +k+rw+++ Mapoly0132s0031.1.p 134 RDPWTEVEDMRLFLAHKRFGSK-WSQICSILP-GRSENGVKNRWNTH 178 799*******************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.502 | 25 | 76 | IPR017930 | Myb domain |
SMART | SM00717 | 3.1E-15 | 29 | 78 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.76E-16 | 31 | 82 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 7.1E-15 | 32 | 76 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.7E-22 | 32 | 92 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.52E-12 | 32 | 76 | No hit | No description |
PROSITE profile | PS51294 | 27.204 | 77 | 132 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.57E-29 | 80 | 175 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.3E-14 | 81 | 130 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.6E-17 | 82 | 128 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.42E-11 | 85 | 126 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.5E-24 | 93 | 134 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 15.857 | 133 | 183 | IPR017930 | Myb domain |
SMART | SM00717 | 2.2E-12 | 133 | 181 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.8E-12 | 134 | 178 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.5E-20 | 135 | 182 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.03E-7 | 136 | 179 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 221 aa Download sequence Send to blast |
MEECNMEVEV SHLESKKQHV TGASSMRKRV ERWTPEEDEL LQEAVVQYKA KNWRLVAKAV 60 PNRTEIQCLQ RWQKVLNPAI VKGYWTKEED QKMLELVGML GTKRWAAVAR SLPGRIGKQC 120 RERWYNQLDP SIKRDPWTEV EDMRLFLAHK RFGSKWSQIC SILPGRSENG VKNRWNTHIK 180 KKAFILEEYC RMLNNQQNPS QNEELLGNEA AKKDLLSILE * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 1e-59 | 32 | 183 | 8 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 1e-59 | 32 | 183 | 8 | 159 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (By similarity). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). {ECO:0000250|UniProtKB:Q94FL9, ECO:0000269|PubMed:26069325}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by ethylene, auxin (IAA), jasmonic acid (JA) and salicylic acid (SA). {ECO:0000269|PubMed:16463103}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002505942.1 | 1e-64 | predicted protein, partial | ||||
Swissprot | Q8H1P9 | 3e-62 | MB3R3_ARATH; Transcription factor MYB3R-3 | ||||
TrEMBL | A0A2R6W7Y0 | 1e-161 | A0A2R6W7Y0_MARPO; Uncharacterized protein | ||||
STRING | XP_002505942.1 | 5e-64 | (Micromonas sp. RCC299) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G09370.1 | 1e-64 | myb domain protein 3r-3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Mapoly0132s0031.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|