PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Mapoly0053s0058.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 158aa MW: 17923.6 Da PI: 6.2674 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 117.2 | 7.8e-37 | 24 | 110 | 12 | 98 |
NF-YC 12 katdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98 + +fk h +Plari++i++ad dv+misae+Pvl+++ace+fi +lt r+w +a+e+ rrt++ksdi ++v+ t+i dfl di p Mapoly0053s0058.1.p 24 PVMEFKAHPIPLARIRRIMRADADVNMISAETPVLFARACEMFIEDLTARAWKKAQESGRRTVNKSDIVQIVSGTKILDFLDDILPP 110 5689*******************************************************************************9985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 5.28E-25 | 27 | 104 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.8E-20 | 33 | 93 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene3D | G3DSA:1.10.20.10 | 6.1E-30 | 34 | 109 | IPR009072 | Histone-fold |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MERMDRPPRP RPHERQMEGA QTPPVMEFKA HPIPLARIRR IMRADADVNM ISAETPVLFA 60 RACEMFIEDL TARAWKKAQE SGRRTVNKSD IVQIVSGTKI LDFLDDILPP EWASGSKPEQ 120 DRMEETPPKP FPDAVSDFVS LSCAQNSQNY FTMCHLI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 2e-30 | 27 | 109 | 12 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004495741.1 | 4e-30 | nuclear transcription factor Y subunit C-3-like | ||||
Refseq | XP_004495742.1 | 4e-30 | nuclear transcription factor Y subunit C-3-like | ||||
Swissprot | Q9ZVL3 | 3e-29 | NFYC3_ARATH; Nuclear transcription factor Y subunit C-3 | ||||
TrEMBL | A0A2R6WW94 | 1e-112 | A0A2R6WW94_MARPO; Uncharacterized protein | ||||
STRING | XP_004495741.1 | 2e-29 | (Cicer arietinum) | ||||
STRING | EFJ28198 | 4e-30 | (Selaginella moellendorffii) | ||||
STRING | EFJ29692 | 4e-30 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP315 | 17 | 117 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G54830.3 | 2e-23 | nuclear factor Y, subunit C3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Mapoly0053s0058.1.p |