PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0032s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family HB-other
Protein Properties Length: 2056aa    MW: 221515 Da    PI: 4.9758
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0032s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox17.38e-06746795756
                          --HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++e l+ ++e+F+ + +++++e +e+++ +g t +qV+ +Fq +R   k
  Mapoly0032s0010.1.p 746 PSAEALKSMKEVFAIKDTITKKEAREISSMTGATVTQVREFFQTQRNLVK 795
                          78999**************************************9997655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.9E-5737796IPR009057Homeodomain-like
SMARTSM003891.9E-4739801IPR001356Homeobox domain
SuperFamilySSF466895.13E-6740802IPR009057Homeodomain-like
CDDcd000867.23E-4740796No hitNo description
Gene3DG3DSA:1.20.930.101.2E-7877967IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476761.07E-5877967IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 2056 aa     Download sequence    Send to blast
MEPEADVHEG AGESSSFGSV LELGGEPRTE CTYSVPNEIN EGLAEMPEQN YGSSLDMTPD  60
IGRESYALRP GIEFSTDLRM ELSADVLASL GGSSNDVEKP PEDNLLDISS MREDLRTELQ  120
FIQELSMSPP PDPVNSSDPG NFTSEGANTH TEADSGAYGP VDSVSAEVQY DCAVPASTDS  180
DSPVHAQVDP TLGETVNDQV HPSVFETSAQ TPVEATSNMV SFAASLSFPM TSMNARTLEV  240
VGSTYYENCP VASGPDMLPS DRVVYHPVDV ASNSQSTNTT VTPLSVLDAT GGGNETSSPF  300
EVEGTASAIA LVTSDVNSCG DKDTKTTELE ESAVTYVPSS EEEACFFSVA VGTDSLQVPS  360
ERISPPAAER AQGLSPSSSP VDFSKNIHER PAVSGDDDVG QDVPVFPSTL TMGESCSLDS  420
GHLRDENSAV KLPELAALGS YGTGRFSGVA DHEVASSTAE GSAVIHVEKF QTESHSSFAQ  480
DLPEAQADLS NTCSADVLVV SAVQALPLFS RVEASEGNKQ IGFLHLPTQA PPLSSPSLVS  540
EMELHSSVNG QSSPPRDSSA PSGNVSPVAY APPYSPEPPV IQATPGSADA IISKSEAPAR  600
LEPSLLSPKA PRADSETSLL SARPGHFWDV PSSSGRSLPA LPTLSAYFDG SRSPFRGRKT  660
ARRKKSSESV FDSKGKTSGE MDRMDEVVEL ENMIEAQKKT MQWQIDELQR IMMKQCELTG  720
KNPLSEEMIY EVLGEKGADK KLGEVPSAEA LKSMKEVFAI KDTITKKEAR EISSMTGATV  780
TQVREFFQTQ RNLVKKLVQQ VYDETGRVGI KNASEQSQPS IPTISNNVGV ERDLGFHKLT  840
SIESVERSLE LMRAERTFFG QMQLLQIILQ TEAGALILRR FLEKGGLKVV GGWLVEAAAE  900
EQTSVLRQLL KVLGHLPISQ SVPHQMPALV QNVNKLRFYQ NSDISSQARA LLAMWSKMLK  960
QKTEAPKPAA AVTGKPTAAL ERNLASAPGV QKRNRETLSV THGGSGPRKK KAKEEETSQT  1020
DLKASGVPSM GSPSRNISGL VVVDPTVSNQ PSVPNPPPAA KQRWSHTLQP SESAVAAVSV  1080
SRKRVVSKSL GDHAKERRKL QLVEDKPAGK SFLTGGASKS SISKNSRPLS TDDIYKAKKL  1140
QRLMQEPLTK SRRKAAAAEE TSQTVDVDLK TVPKKSVPPS RPEQQDLSRG STGNTSVSDY  1200
QFLNKRVSST AGIIERTEVS KWETLASRLQ QDMYQPSITP TSSPDRGQRT ITPTASPDRP  1260
QLIITPIASP ERPPIEKPNS PPDLSEIVST PLSPEDIPQR VITSTSDRSQ GILSSAAILD  1320
SIPQKTYPKS TSVSADESQI FTPFSSNPGL MESVHHAMIP QQVQQPTDTL VPGFPFACKE  1380
PSDATVFPVG GEVVRPTENM PRDNPVSVTV TNTHPAFLDQ NHPSAPVSGQ LYPQMESGRP  1440
ATGVPLYTIP SPTPENEVEV KEGQQFVESS SSRFPPKEPA VIDFYAALRA NMIRWRIPAE  1500
FHLDPQWNVA AGEDSKEKEM QSARVKREEE AYYPDASTIP SDPKDPWEEE PNYDDSLTFE  1560
IFLDNNHRKA ASAMQISTDH MSAPTTNVMP SGIAPNSFMA EPSNNMFQPG SGYSAADSSV  1620
DQSRRVPNVS GLDLLLQQLS AGGGVAHDPA LLTLLLQNPD LVNQLTAGQG YPQSGNTTQN  1680
VFAPPLDSLK QSSNSGNLGV GLRTSAGDLG LDRVGASNIS VTMPPDTMRV EDSALKHSYS  1740
GMGHQQNPGF VTQVGVDNRY SAPPQMQPAV GSNSGWEQGR MPPLPPLPPP PPLPPMPSGG  1800
NQVLQSSVQP QANKVTNWPE PQQAWNSVGT VVGRPAVNTA QIHSGQELHM RPQNIMTHNV  1860
RPPNYGGMVP IPQVEVSSVV SQQEMHNASQ RQWTNAAHLV IAPSANDNSM IQAGQESGAG  1920
RNNRWPRPPG PPPPPPPPDP QMRPVGREYS DFQGNRQANV AENMTVWVPN ERGRPGPPPF  1980
QGSYRPPPPP PPPPYPAPQQ QHWQQTPERN VRPVQTSAVP PYPPHGRDLR TQQQPPQPWH  2040
PNMGPPPRPM WRGPQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2R6X6S70.0A0A2R6X6S7_MARPO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP41211315
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.26e-44HB-other family protein