PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010109305.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 145aa MW: 17084.7 Da PI: 9.126 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 27.1 | 7.2e-09 | 87 | 121 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 k +yp++ +++ L++ +gL+++q+ +WF N+R ++ XP_010109305.1 87 KWPYPTEGDKAALSELTGLDQKQINNWFINQRKRH 121 669*****************************885 PP | |||||||
2 | ELK | 38.8 | 1.9e-13 | 41 | 62 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK+ LlrKYsgy+++Lk+EFs XP_010109305.1 41 ELKDKLLRKYSGYISTLKHEFS 62 9********************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51213 | 10.772 | 41 | 61 | IPR005539 | ELK domain |
Pfam | PF03789 | 2.7E-11 | 41 | 62 | IPR005539 | ELK domain |
SMART | SM01188 | 8.9E-8 | 41 | 62 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 11.451 | 61 | 124 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 5.43E-19 | 62 | 134 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 7.6E-10 | 63 | 128 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 3.5E-27 | 66 | 124 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 6.02E-10 | 73 | 122 | No hit | No description |
Pfam | PF05920 | 7.6E-17 | 81 | 120 | IPR008422 | Homeobox KN domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 145 aa Download sequence Send to blast |
MIVVDGCYCE RYICTSSLKL SGGEIQVVDI MSRQFANEDR ELKDKLLRKY SGYISTLKHE 60 FSKKKKKGKL PKEARQILLD WWTLHYKWPY PTEGDKAALS ELTGLDQKQI NNWFINQRKR 120 HWTPPENMQV AIMEAHSLYG SFCHE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010109305.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010109305.1 | 1e-107 | homeobox protein knotted-1-like 4 | ||||
Swissprot | Q84JS6 | 2e-49 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
TrEMBL | W9S234 | 1e-105 | W9S234_9ROSA; Homeobox protein knotted-1-like 6 | ||||
STRING | XP_010109305.1 | 1e-106 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF620 | 34 | 125 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.1 | 1e-45 | KNOTTED1-like homeobox gene 6 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 21384521 |
Publications ? help Back to Top | |||
---|---|---|---|
|