PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010106738.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family STAT
Protein Properties Length: 770aa    MW: 87295.5 Da    PI: 5.6966
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010106738.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT1803.3e-562723931122
            STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkky 95 
                     ldvv++++ g+p++ ++evvasL+y d+g++ve+++d eapLL+sydG+ef+s++rp+kll+GrasfklkisqLsskc nrLfrikf++pk+++y
  XP_010106738.1 272 LDVVFIDTSGHPIREEMEVVASLVYLDNGAPVERTSDGEAPLLASYDGLEFTSYERPSKLLHGRASFKLKISQLSSKCQNRLFRIKFHLPKMETY 366
                     8********************************************************************************************** PP

            STAT  96 pfleavskpirCisrsrntrsssltkk 122
                     pf+ea+s pir isr+rntr ss+++k
  XP_010106738.1 367 PFFEAFSPPIRSISRNRNTRLSSVVWK 393
                     **********************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd103384.59E-57652761No hitNo description
Gene3DG3DSA:3.30.505.104.6E-8655745IPR000980SH2 domain
SuperFamilySSF555501.66E-8659746IPR000980SH2 domain
PROSITE profilePS5000110.716663770IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 770 aa     Download sequence    Send to blast
MADEVALERE NYSLLKNLRV EIEGEKEKTF SLCFWLYLVN STTLPLSILQ KVHPDVTGNS  60
PFLVIHEKKV KLFPLLPSRK EDPESEVPHA SVEVEFEFSQ EKWVHFGCEC FNDAGTFSMV  120
IAGRGIYKNH SFSIHVNVNR RVDLVHLHLI SKLLGLLWIV VEDVSTDFLR LHIDGEIVGE  180
KSLSSALETD SNFNGFVKLT LVGGAGDDSR DQGYIYNLKT FATTSSIKDH CAKDPPVQLS  240
IDKSSASEIE EGDGGVWSIV GGKASCRRNF SLDVVFIDTS GHPIREEMEV VASLVYLDNG  300
APVERTSDGE APLLASYDGL EFTSYERPSK LLHGRASFKL KISQLSSKCQ NRLFRIKFHL  360
PKMETYPFFE AFSPPIRSIS RNRNTRLSSV VWKRCTSALH PISQSSEMDE DMLEVRQNSL  420
HETKPNPSSK RLRLGQDRIS TNFRADPPLE APDEECNSHA WTANKVENEF MKSSTMEHEN  480
LEEDNSSSGS ESIEARNSAP KGSSSTRNQI SDLTVFKYSL ANLSERSLLL KEIANSASNE  540
EILNFAHQVS LYSGCSHHRN QIIMAKRLVE EGTKAWNLIS QNTNKVQWES MVFDIEGQFM  600
KISRCSSRSL TQQDFDLLRR ICGCQEYVAQ ENFEQMWCWL YPIAYALSRD WINAMWSSTS  660
PRWIEGFITK EEAESSLQGP RGLQEPGTFV LRFPTSRIWP HPDAGSLVVT YVGSDYAIHH  720
KLLSLDHVYS SAENEKDVKP LQDMLLEEPE LSRLGRQDYL ITLFNLFSRL
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_010106738.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024028241.10.0SH2 domain-containing protein A
TrEMBLW9S5N40.0W9S5N4_9ROSA; Uncharacterized protein
STRINGXP_010106738.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67103036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.20.0SH2 domain protein B