PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010094805.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 228aa MW: 25294.9 Da PI: 4.8979 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 88.5 | 3.5e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskRr g++KKA+ELS+LCdae a+i+fsstgklyeyss XP_010094805.1 9 KKIDNITARQVTFSKRRRGLFKKAQELSTLCDAEMALIVFSSTGKLYEYSS 59 68***********************************************96 PP | |||||||
2 | K-box | 32.5 | 3.6e-12 | 127 | 165 | 36 | 74 |
K-box 36 RhllGedLesLslkeLqqLeqqLekslkkiRskKnelll 74 R+++Ge+Le+L+l eL++Le+ +e++l ++ +kK +l++ XP_010094805.1 127 RQMKGEELEELNLDELKKLEKLVETGLGRVIEKKFNLII 165 9*********************************99886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.081 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 6.4E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 5.1E-31 | 2 | 77 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.53E-41 | 3 | 75 | No hit | No description |
PRINTS | PR00404 | 4.8E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.2E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.8E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.8E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.8E-7 | 127 | 165 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 228 aa Download sequence Send to blast |
MTRQKIEIKK IDNITARQVT FSKRRRGLFK KAQELSTLCD AEMALIVFSS TGKLYEYSSS 60 SMQQILERHN FHSENPERLI SQPSLDELES TRESGLLSFV FAYSLWCQTL LALVPTFGLV 120 LVGPVFRQMK GEELEELNLD ELKKLEKLVE TGLGRVIEKK FNLIICEGDP ATRSQPTIET 180 ALKQTAGAIV VPADPGEQGQ SSDSITGICS SADLPEDHDS SDTALKLG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 4e-20 | 1 | 96 | 1 | 93 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 4e-20 | 1 | 96 | 1 | 93 | Myocyte-specific enhancer factor 2B |
1tqe_R | 4e-20 | 1 | 96 | 1 | 93 | Myocyte-specific enhancer factor 2B |
1tqe_S | 4e-20 | 1 | 96 | 1 | 93 | Myocyte-specific enhancer factor 2B |
6c9l_A | 4e-20 | 1 | 96 | 1 | 93 | Myocyte-specific enhancer factor 2B |
6c9l_B | 4e-20 | 1 | 96 | 1 | 93 | Myocyte-specific enhancer factor 2B |
6c9l_C | 4e-20 | 1 | 96 | 1 | 93 | Myocyte-specific enhancer factor 2B |
6c9l_D | 4e-20 | 1 | 96 | 1 | 93 | Myocyte-specific enhancer factor 2B |
6c9l_E | 4e-20 | 1 | 96 | 1 | 93 | Myocyte-specific enhancer factor 2B |
6c9l_F | 4e-20 | 1 | 96 | 1 | 93 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010094805.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024020322.1 | 1e-100 | MADS-box protein JOINTLESS isoform X4 | ||||
Swissprot | Q9FUY6 | 2e-58 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
TrEMBL | W9R7S1 | 1e-166 | W9R7S1_9ROSA; MADS-box protein JOINTLESS | ||||
STRING | XP_010094805.1 | 1e-167 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF890 | 33 | 106 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 3e-43 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 21394639 |
Publications ? help Back to Top | |||
---|---|---|---|
|