PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010091613.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 261aa MW: 30449.7 Da PI: 8.4497 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 100.1 | 8.7e-32 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRrng+lKKA+E+SvLCdaevavi+fs++gkl+eys+ XP_010091613.1 9 KRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAVIVFSHKGKLFEYST 59 79***********************************************96 PP | |||||||
2 | K-box | 67.2 | 5.7e-23 | 85 | 190 | 9 | 100 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK..............nellleqieelqkkekelqe 89 e++ + +++ e+++L ++ie Lqr+ h+lGe+LesLs k++q+LeqqL+++lk+iR++K n+l+ e i+elqkkek+++e XP_010091613.1 85 SESHFQGNWTVEYSRLTAKIELLQRNRSHFLGENLESLSQKDIQNLEQQLDTALKNIRARKiryitytetiftlqNQLMNETISELQKKEKAMRE 179 45555679****************************************************87777776666666689****************** PP K-box 90 enkaLrkklee 100 +n+ L+kk++e XP_010091613.1 180 QNNVLEKKIKE 190 ********987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.464 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.9E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.79E-43 | 2 | 79 | No hit | No description |
SuperFamily | SSF55455 | 6.15E-35 | 2 | 89 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.9E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.9E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.9E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.9E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 4.7E-23 | 86 | 188 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.45 | 90 | 194 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009933 | Biological Process | meristem structural organization | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 261 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVAVIVFSH KGKLFEYSTD 60 SCMEKILERY ERYSYAERQL VTMDSESHFQ GNWTVEYSRL TAKIELLQRN RSHFLGENLE 120 SLSQKDIQNL EQQLDTALKN IRARKIRYIT YTETIFTLQN QLMNETISEL QKKEKAMREQ 180 NNVLEKKIKE KEKSVAVEAQ QMQWEQQHHG ASTSSYLLPQ PLPCLNIGGT YNGEEAPEMR 240 RNDLELTLEP LYSCHLGCFA A |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 4e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 4e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 4e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 4e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 4e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 4e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 4e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 4e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00096 | ChIP-seq | Transfer from AT1G69120 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010091613.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ506153 | 1e-162 | KJ506153.1 Ficus carica MADS-box protein (MADS2) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024018304.1 | 1e-174 | truncated transcription factor CAULIFLOWER A isoform X2 | ||||
Swissprot | Q6E6S7 | 1e-132 | AP1_VITVI; Agamous-like MADS-box protein AP1 | ||||
TrEMBL | W9QYY0 | 0.0 | W9QYY0_9ROSA; Floral homeotic protein APETALA 1 | ||||
STRING | XP_010091613.1 | 0.0 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF588 | 32 | 119 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69120.1 | 1e-115 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 21409118 |
Publications ? help Back to Top | |||
---|---|---|---|
|