PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013906239.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family G2-like
Protein Properties Length: 359aa    MW: 38408.8 Da    PI: 7.1303
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013906239.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.81.8e-31151205155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+rlrWtpeLH++Fv+ v+qLGG++kAtPk il++m+++gLt+ h+kSHLQkYRl
  XP_013906239.1 151 KTRLRWTPELHSSFVRSVQQLGGPDKATPKGILKAMNMDGLTIFHIKSHLQKYRL 205
                     68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-28150206IPR009057Homeodomain-like
SuperFamilySSF466895.91E-17150206IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-24151206IPR006447Myb domain, plants
PfamPF002495.6E-7153204IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MQQDLLGGPP GPMHHDEQHE MLQQQPQQQQ AQPQAQQQQQ QQHPQQQHQQ HQHLPGKAAF  60
PPGMGVPGMD HFHGTPYGMQ AVPMQPGHFE HLLNAMPVTG HSLSSSFATD NVHMSGAQPT  120
LYLAAGFNMA GSKPGVSAAG SAGGGGGGGS KTRLRWTPEL HSSFVRSVQQ LGGPDKATPK  180
GILKAMNMDG LTIFHIKSHL QKYRLNARVP GASSVDGGSD GCAAGDSAEG NSGSRPASAA  240
LDGLGSVPVS ALTRKNLEDA LVLQMELQKK LHEQLELLLL LLLLLLLLLL MLLLLLLLLL  300
LLLLLLLLLL LLLLLLLLLL LLLLLLLLRL LSLEPRRSCD GSVACSCSCA EVFISGELY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A9e-22151204154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-22151204154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-22151204154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-22151204154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013906239.10.0hypothetical protein MNEG_0733
TrEMBLA0A0D2MXL50.0A0A0D2MXL5_9CHLO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1111645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.14e-26G2-like family protein
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]