PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013905908.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family GATA
Protein Properties Length: 386aa    MW: 40192.7 Da    PI: 7.4051
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013905908.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA45.97.9e-15323357135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C +Cg+ ++p+WR+gp  ++ LCnaCG ++r++++
  XP_013905908.1 323 CMHCGVDESPQWRKGPPHKSVLCNACGTRWRRTHQ 357
                     99**************88888**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004014.0E-10317369IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.65E-11320360No hitNo description
CDDcd002023.24E-13322364No hitNo description
PfamPF003201.0E-12323357IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.1E-11323357IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS501149.367323349IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MSYLDVDSCM LASSGYQSAK NFLLLDELPS PLDACGPDRG APRGGVLSQL PAPGLLLPLP  60
EDDPTACAGM QPPAMHHNYH HAVAAAASQQ QPHHHPLAGG SCREPAFGPA APAPFAPAGE  120
LQQLHAWQSM LTQQQQQQQQ QPYYQQQLLL QQQYTHMQQP AHAHALPQPR RVYQLVLLDD  180
ATGRPLRTAT DDDAAHVARM LESDSGSSGL SATASLPRAM SFVGSAGAVA AMAAAAGNEE  240
EEVGEEVGAA AAGGGGSGGG ARDQGNAKRR NSGKAAGGGS SVGARSQQEG DQRQQRPEGS  300
ASPAQLLRAQ APKPAAEKRT GPCMHCGVDE SPQWRKGPPH KSVLCNACGT RWRRTHQLGP  360
PVASSVLRAA GAAGSKRKAQ EFGGDS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013905908.10.0hypothetical protein MNEG_1062
TrEMBLA0A0D2LKF60.0A0A0D2LKF6_9CHLO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP4501526
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.16e-13GATA transcription factor 26
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]