PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013905703.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
|
||||||||
Family | Whirly | ||||||||
Protein Properties | Length: 132aa MW: 14211 Da PI: 7.6708 | ||||||||
Description | Whirly family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Whirly | 89.8 | 3.1e-28 | 3 | 129 | 11 | 136 |
Whirly 11 vkavrptfeald..sgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpa.akgsneGkvrkalkvePlpdG 102 vk +pt++ + +g ++++r G +lle+a a +er+y W++k s+a+sate++++ +++ +f+hdp ++ s +G v kal+ pdG XP_013905703.1 3 VKFLKPTWVPANspGGGFTMDRVGKVLLEFAAASGERQYSWDNKISLAMSATELGQIFA-DPNQEHSFYHDPNiMDASSRGAVSKALRWSLAPDG 96 556666666544116899*************************************9875.789999******999******************** PP Whirly 103 sGlfvnlsvtnslvkgnesfsvPvskaefavlrs 136 +f++ s+ + ++ +++vP+++ae+ v+ s XP_013905703.1 97 KAYFISASIGGT-SATKANITVPLTRAEYYVFES 129 ********9877.789999*********998765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF08536 | 2.8E-29 | 1 | 130 | IPR013742 | Plant transcription factor |
Gene3D | G3DSA:2.30.31.10 | 6.1E-27 | 1 | 130 | IPR009044 | ssDNA-binding transcriptional regulator |
SuperFamily | SSF54447 | 8.63E-16 | 18 | 129 | IPR009044 | ssDNA-binding transcriptional regulator |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006281 | Biological Process | DNA repair | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0045910 | Biological Process | negative regulation of DNA recombination | ||||
GO:0005739 | Cellular Component | mitochondrion | ||||
GO:0009570 | Cellular Component | chloroplast stroma | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0003723 | Molecular Function | RNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MAVKFLKPTW VPANSPGGGF TMDRVGKVLL EFAAASGERQ YSWDNKISLA MSATELGQIF 60 ADPNQEHSFY HDPNIMDASS RGAVSKALRW SLAPDGKAYF ISASIGGTSA TKANITVPLT 120 RAEYYVFESV GA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1l3a_A | 5e-18 | 1 | 129 | 51 | 178 | p24: plant transcriptional regulator PBF-2 |
1l3a_B | 5e-18 | 1 | 129 | 51 | 178 | p24: plant transcriptional regulator PBF-2 |
1l3a_C | 5e-18 | 1 | 129 | 51 | 178 | p24: plant transcriptional regulator PBF-2 |
1l3a_D | 5e-18 | 1 | 129 | 51 | 178 | p24: plant transcriptional regulator PBF-2 |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013905703.1 | 3e-94 | transcription factor | ||||
TrEMBL | A0A0D2LK05 | 7e-93 | A0A0D2LK05_9CHLO; Transcription factor |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP2026 | 15 | 16 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71260.1 | 2e-19 | WHIRLY 2 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 25729989 |
Publications ? help Back to Top | |||
---|---|---|---|
|