PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013903230.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 86aa MW: 9800.21 Da PI: 7.2552 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 136 | 1.1e-42 | 1 | 80 | 17 | 96 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 mkkvlPanaki+kdake +qec sefisf+tseas kcq+ekrktingddllwa+ tl fedyv+pl++yl+kyre+e+ XP_013903230.1 1 MKKVLPANAKIAKDAKEAIQECTSEFISFITSEASAKCQAEKRKTINGDDLLWAMETLQFEDYVAPLRLYLSKYREAEAS 80 9***************************************************************************9976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.1E-41 | 1 | 85 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.09E-31 | 1 | 85 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.2E-20 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 6.0E-19 | 19 | 37 | No hit | No description |
PRINTS | PR00615 | 6.0E-19 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 6.0E-19 | 57 | 75 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 86 aa Download sequence Send to blast |
MKKVLPANAK IAKDAKEAIQ ECTSEFISFI TSEASAKCQA EKRKTINGDD LLWAMETLQF 60 EDYVAPLRLY LSKYREAEAS TQKHKE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_B | 2e-34 | 1 | 76 | 19 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 2e-34 | 1 | 76 | 19 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013903230.1 | 2e-57 | Nuclear transcription factor Y subunit B | ||||
Swissprot | O23310 | 1e-42 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A0D2NGS2 | 4e-56 | A0A0D2NGS2_9CHLO; Nuclear transcription factor Y subunit B | ||||
STRING | Gorai.002G250600.1 | 5e-42 | (Gossypium raimondii) | ||||
STRING | PP1S25_89V6.1 | 5e-42 | (Physcomitrella patens) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP2023 | 16 | 16 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 6e-45 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 25736631 |
Publications ? help Back to Top | |||
---|---|---|---|
|