PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013895410.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 80aa MW: 8830.55 Da PI: 10.8224 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 43 | 9.2e-14 | 22 | 78 | 12 | 68 |
S1FA 12 nPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavP 68 nP +l v ll+vf+ +n l+ +aqkn P + kk v k++kre l++G+a+P XP_013895410.1 22 NPVPTILATVLVLLVVFIGANVGLWWWAQKNAPAKPKKKVGAKQMKRETLRRGLAMP 78 6777788888899999999***********************************999 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04689 | 1.6E-11 | 22 | 78 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 80 aa Download sequence Send to blast |
MPTHFPPLYS DIADLAGKDL PNPVPTILAT VLVLLVVFIG ANVGLWWWAQ KNAPAKPKKK 60 VGAKQMKRET LRRGLAMPQD |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013895410.1 | 7e-52 | hypothetical protein MNEG_11574 | ||||
TrEMBL | A0A0D2MNV5 | 2e-50 | A0A0D2MNV5_9CHLO; Uncharacterized protein |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 25728850 |
Publications ? help Back to Top | |||
---|---|---|---|
|