PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013894242.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family G2-like
Protein Properties Length: 479aa    MW: 48096.1 Da    PI: 6.5176
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013894242.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.94.7e-28102155155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr++W+ e+H++Fv av+qL G+ekA Pk+ilelm+v+gLt+e+v+SHLQkYRl
  XP_013894242.1 102 KPRVVWSVEMHQQFVAAVNQL-GIEKAAPKKILELMNVEGLTRENVASHLQKYRL 155
                     79*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.01E-6146IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23004.5E-9146No hitNo description
PROSITE profilePS5011014.275139IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5129410.2399158IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.9E-3099160IPR009057Homeodomain-like
SuperFamilySSF466893.76E-19100159IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-23102155IPR006447Myb domain, plants
PfamPF002491.1E-5104154IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MSSNGEHTTV LRGVTHGACD FLIKPVRIEE LRNIWQHVVR RQKSLSHSEK DADGDGTMDS  60
ENNSRKRKEG GSTSGGEVRA PPPADPRPLA ALRDEEGSSS KKPRVVWSVE MHQQFVAAVN  120
QLGIEKAAPK KILELMNVEG LTRENVASHL QKYRLYLRRV QGVHSGGDGA GDVGGSGGGA  180
KPDAAGPEQQ QQPPEPQQQQ QQQPAPVTKQ EAEDMGAAPK PAPAPSLAPP QQQPAPAPAP  240
APAPVAQAPA PAPAPAPVPA PAPAAVMGPP GMMPPGMPGM PMGGPMGMNP MMMGMGPMAM  300
GMPGMAPPMM GGMGPMGMPP GMAPPGMPMG VPGMPMVPPP GMAPPDPSQM FSMIGMAMSM  360
GMHPPGAYPP HAAAPPAAAL PPGAGGAAAR GAMPPPAPVR QQRGAGAGAG VTAGGGAVPM  420
ETSEFAGMFD DPFGGLAAAP AGPGVGTGPG HAGVGGGSGN GGGGDDGVGE FLDYFLKSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-2398160163ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013894242.10.0Two-component response regulator ARR12
TrEMBLA0A0D2J5S30.0A0A0D2J5S3_9CHLO; Two-component response regulator ARR12
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP12201516
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.13e-49response regulator 2
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]