PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013893719.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 112aa MW: 12813.7 Da PI: 9.7571 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58 | 2.1e-18 | 9 | 54 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 W++eEd +l+d+v ++G+ +W++Ia +mg gR k+c++rw++ XP_013893719.1 9 ATWSPEEDARLLDLVGRYGPQNWTAIAGHMGGGRNSKSCRLRWFNQ 54 58*****************************************996 PP | |||||||
2 | Myb_DNA-binding | 52.3 | 1.3e-16 | 61 | 102 | 1 | 44 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 + ++T+eE + +++ ++q+G++ W++Ia++++ gRt++ +k++w XP_013893719.1 61 KEPFTEEEKQVIIEMHAQMGNK-WALIAKHLP-GRTDNAIKNYW 102 679*******************.*********.*********** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 24.29 | 1 | 59 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.01E-31 | 7 | 102 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.6E-14 | 7 | 57 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.4E-17 | 9 | 54 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.19E-11 | 10 | 53 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.4E-24 | 10 | 62 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.048 | 60 | 109 | IPR017930 | Myb domain |
SMART | SM00717 | 5.8E-13 | 60 | 108 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.5E-15 | 61 | 103 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.8E-23 | 63 | 103 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.22E-11 | 63 | 102 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0051782 | Biological Process | negative regulation of cell division | ||||
GO:0071367 | Biological Process | cellular response to brassinosteroid stimulus | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 112 aa Download sequence Send to blast |
MGFTVVKRAT WSPEEDARLL DLVGRYGPQN WTAIAGHMGG GRNSKSCRLR WFNQLDPRVN 60 KEPFTEEEKQ VIIEMHAQMG NKWALIAKHL PGRTDNAIKN YWCARDALCG RT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 2e-32 | 8 | 102 | 4 | 97 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 2e-32 | 8 | 102 | 4 | 97 | C-Myb DNA-Binding Domain |
1msf_C | 2e-32 | 8 | 102 | 4 | 97 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269|PubMed:20305120}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00516 | DAP | Transfer from AT5G17800 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by wounding. {ECO:0000269|PubMed:20305120}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | - | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013893719.1 | 7e-81 | Transcription factor GAMYB | ||||
Swissprot | Q5NBM8 | 2e-37 | CSA_ORYSJ; Transcription factor CSA | ||||
TrEMBL | A0A0D2LSW6 | 2e-79 | A0A0D2LSW6_9CHLO; Transcription factor GAMYB | ||||
STRING | Sb05g009460.1 | 1e-37 | (Sorghum bicolor) | ||||
STRING | XP_005848340.1 | 1e-37 | (Chlorella variabilis) | ||||
STRING | LPERR11G05690.1 | 1e-37 | (Leersia perrieri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP15 | 16 | 114 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G17800.1 | 3e-39 | myb domain protein 56 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 25730708 |