PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013893355.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family GATA
Protein Properties Length: 177aa    MW: 19096.8 Da    PI: 8.6596
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013893355.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.11e-1779111133
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkk 33 
                     C  Cg+t+Tp+WR+gp g++tLCnaCG+++++ 
  XP_013893355.1  79 CYECGATNTPQWREGPTGPRTLCNACGMRFQRS 111
                     99***************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.3E-1173127IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.99173109IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.14E-1276110No hitNo description
Gene3DG3DSA:3.30.50.104.8E-1576125IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.22E-1478122No hitNo description
PfamPF003203.4E-1579110IPR000679Zinc finger, GATA-type
PROSITE patternPS00344079104IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MAAVASRAGK QGGQAVYAAG NGLLPPMDVE LFQPAAEPPK RGRGGRRGGG GRGGGRRGGR  60
QQRREFSSSG GQGIPGEVCY ECGATNTPQW REGPTGPRTL CNACGMRFQR SQGKGQNRPR  120
RSASAELELG ERKVARTARG RGRGRGRGRW SRDEEFFDDE DEDEETDDLV LSDEDDD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14350GGRRGGGG
24655RGGGGRGGGR
3138147RGRGRGRGRG
4138148RGRGRGRGRGR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00377DAPTransfer from AT3G24050Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013893355.11e-121hypothetical protein MNEG_13626
TrEMBLA0A0D2MH061e-120A0A0D2MH06_9CHLO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2201430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.11e-12GATA transcription factor 1
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]