PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013892274.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family GATA
Protein Properties Length: 380aa    MW: 38878.4 Da    PI: 10.0527
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013892274.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA50.43e-16257291135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     Cs+Cgt ++++WR+gp+ +++LCnaCGl++ k+++
  XP_013892274.1 257 CSHCGTQSSSQWRSGPQEKPCLCNACGLFWSKRRS 291
                     ****************99999***********986 PP

2GATA412.7e-13307340135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C +Cg+ ++ +WR gp+g   LC +CGl+yrk+++
  XP_013892274.1 307 CNHCGADSSNQWRAGPEGVA-LCDPCGLHYRKTKT 340
                     ********************.***********976 PP

3GATA30.74.5e-10356380125
            GATA   1 CsnCgttkTplWRrgpdgnktLCna 25 
                     C++Cgt  +p+WR gp   + LCna
  XP_013892274.1 356 CHHCGTRFSPQWRGGPPEASVLCNA 380
                     ****************99999***8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004015.9E-8251302IPR000679Zinc finger, GATA-type
SuperFamilySSF577168.08E-10253291No hitNo description
CDDcd002023.40E-12256290No hitNo description
PROSITE patternPS003440257282IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.104.0E-12257290IPR013088Zinc finger, NHR/GATA-type
PfamPF003202.1E-13257291IPR000679Zinc finger, GATA-type
PROSITE profilePS5011410.515257285IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.5E-10301344No hitNo description
SMARTSM004012.1E-5303350IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.1E-9305343IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011412.295307336IPR000679Zinc finger, GATA-type
PfamPF003206.3E-11307340IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.75E-5355380No hitNo description
Gene3DG3DSA:3.30.50.102.9E-6356380IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.13E-7356380No hitNo description
PfamPF003205.7E-8356380IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MEAIPVGPHG GDGPTVKQAD ESCRAGSPPA PAPSASIASD TTALQPPASS SAAPGGSTAS  60
AAPAAKLLSL EQLQALMRQQ PRPLIPLLQP LLPLHKAGGA AHQQQLAAAL KSNAAAMAAI  120
AAATAARTAA VQQQQHQQLV AAAKEQDDGK APAAGGAAGA PTAAAGAKAV LSMQPVPLLQ  180
LGFSGPQLLA LKQGSAANAK LTQQLLAAVA KQQQQIQQQQ QIINKGQRMQ AAGLPPLPAA  240
AAAQLLRRGG GSLKGPCSHC GTQSSSQWRS GPQEKPCLCN ACGLFWSKRR SLPEETCKVA  300
VELEGPCNHC GADSSNQWRA GPEGVALCDP CGLHYRKTKT LPKRKRRSLA VAFQGCHHCG  360
TRFSPQWRGG PPEASVLCNA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013892274.10.0hypothetical protein MNEG_14710
TrEMBLA0A0D2LN820.0A0A0D2LN82_9CHLO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP4501526
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47140.14e-09GATA transcription factor 27
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]