PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013890670.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family GATA
Protein Properties Length: 85aa    MW: 8074.04 Da    PI: 11.068
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013890670.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA47.91.8e-15234335
            GATA  3 nCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                    +Cg+ ++p+WR+gp+ ++ +CnaCG +yr++++
  XP_013890670.1  2 HCGVQESPQWRKGPQSKPVVCNACGTRYRRTNS 34
                    9*************99999**********9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501149.539137IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.7E-11235IPR013088Zinc finger, NHR/GATA-type
PfamPF003204.0E-13233IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.7E-10237No hitNo description
SMARTSM004016.7E-5245IPR000679Zinc finger, GATA-type
CDDcd002023.23E-8238No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MHCGVQESPQ WRKGPQSKPV VCNACGTRYR RTNSLGPAIP STARPAAGGG GDGGSAPGGG  60
AKRKAASPPG GSGGGGSKGA AKAAC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013890670.12e-51hypothetical protein MNEG_16315
TrEMBLA0A0D2M8A04e-50A0A0D2M8A0_9CHLO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP4501526
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47140.12e-11GATA transcription factor 27
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]