PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.O00237.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family MYB
Protein Properties Length: 296aa    MW: 34393.4 Da    PI: 8.9427
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.O00237.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.9e-16449147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      rg W + Ede l ++v+++G+++W++Ia +++  R++k+c++rw++ 
  Migut.O00237.1.p  4 RGHWRPAEDEMLRELVERYGPHNWNAIADKLQ-ARSGKSCRLRWFNQ 49
                      899*****************************.***********996 PP

2Myb_DNA-binding56.94.8e-185699146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                      r ++T+eE+e+l+ +++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Migut.O00237.1.p 56 RTPFTEEEEERLLACHRIHGNR-WAIIARLFP-GRTDNAVKNHWHV 99
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.275150IPR017930Myb domain
SMARTSM007173.8E-13352IPR001005SANT/Myb domain
PfamPF002494.5E-16449IPR001005SANT/Myb domain
SuperFamilySSF466893.56E-29497IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.6E-26557IPR009057Homeodomain-like
CDDcd001675.37E-12748No hitNo description
PROSITE profilePS5129427.32451105IPR017930Myb domain
SMARTSM007174.4E-1655103IPR001005SANT/Myb domain
PfamPF002496.5E-155698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-2158104IPR009057Homeodomain-like
CDDcd001672.45E-115898No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MCSRGHWRPA EDEMLRELVE RYGPHNWNAI ADKLQARSGK SCRLRWFNQL DPRINRTPFT  60
EEEEERLLAC HRIHGNRWAI IARLFPGRTD NAVKNHWHVI MARKCRERSK FYNAPKKNST  120
DLNINSQPPP PLSIREHQFE SSTTKSSSII KRVDGDRNSA VCSSRKKIGF ISPLVESAEK  180
FNNPDYYYYY PSPRYNFQFQ GWNKEIQYSQ GPIRRAKIDQ ERSKGVEFYN FLQVNTDSNT  240
SEVIDMHARK CSNPKKNEVE EEEEVDQKAD DDNNQTKANP AALPFIDFFS LGGSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-3111051105C-Myb DNA-Binding Domain
1msf_C1e-3111051105C-Myb DNA-Binding Domain
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.O00237.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012855548.10.0PREDICTED: trichome differentiation protein GL1-like
TrEMBLA0A4D8YPK11e-100A0A4D8YPK1_SALSN; Myb proto-oncogene protein, plant
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73410.14e-73myb domain protein 54