PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.O00093.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family MYB
Protein Properties Length: 390aa    MW: 44648.5 Da    PI: 5.2069
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.O00093.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.5e-17171217148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g WT eEd  l+++v+++G + W++Ia+t+  gR +kqc++rw+++l
  Migut.O00093.1.p 171 KGQWTIEEDRTLIHLVEKYGVRKWSRIAQTLK-GRIGKQCRERWHNHL 217
                       799****************************9.*************97 PP

2Myb_DNA-binding55.81.1e-17223265145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       ++ WT+eEd +l++a+ + G++ W+ Ia++++ gRt++++k++w+
  Migut.O00093.1.p 223 KDQWTEEEDRILIEAHGEIGNK-WAEIAKRLP-GRTENSIKNHWN 265
                       678*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.396166221IPR017930Myb domain
SMARTSM007178.5E-14170219IPR001005SANT/Myb domain
SuperFamilySSF466891.18E-31171264IPR009057Homeodomain-like
PfamPF002493.1E-15171217IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-27172225IPR009057Homeodomain-like
CDDcd001673.02E-13174217No hitNo description
SMARTSM007171.6E-16222270IPR001005SANT/Myb domain
PROSITE profilePS5129422.013222272IPR017930Myb domain
PfamPF002492.5E-16223265IPR001005SANT/Myb domain
CDDcd001674.53E-13226268No hitNo description
Gene3DG3DSA:1.10.10.601.1E-22226271IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MESATNSVND HYAPPPPLSL FNNTLKLETL DYDNETDFCM DNNFCMASFD PFDPFVSAFS  60
SSNSVFDLHE FKNYEENGIT STTTCTYNNF QGDGFLNFPN TKDMLMMEIE TSFLNCGNDN  120
NNNPKPPLGL LSVPDESSAD NFGTKRNRNN SNIINPKNKR NSNAKKSKSA KGQWTIEEDR  180
TLIHLVEKYG VRKWSRIAQT LKGRIGKQCR ERWHNHLRPD IKKDQWTEEE DRILIEAHGE  240
IGNKWAEIAK RLPGRTENSI KNHWNATKRR QFSRRKCRTK WPRPSSLLQN YIKSLNFDNK  300
SSASSRNNNN NNNNINSPII EPTNHGLGLD NASLNSVMEE GSFVQMPEFD DVVDFDFDED  360
RMSIGSFMDD IGDEPCFDLE LPFDMPPLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C9e-481712714104C-Myb DNA-Binding Domain
1msf_C9e-481712714104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.O00093.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012855590.10.0PREDICTED: transcription factor MYB98-like
TrEMBLA0A022Q6H80.0A0A022Q6H8_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.14e-73myb domain protein 98