PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.N02641.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WOX
Protein Properties Length: 172aa    MW: 19941.5 Da    PI: 10.3653
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.N02641.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox51.61.5e-161675357
                      --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                       R+++t+eq+ +L +l+++   +p+ ++ e+++++l    +++ ++V +WFqNr+a+++k
  Migut.N02641.1.p 16 GRWSPTQEQVMVLHALYRSgLTKPNPSQVERITSQLslygRVQSKNVLYWFQNRKARDRK 75
                      6*****************99****************999999****************97 PP

2Wus_type_Homeobox95.16.1e-311475263
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerq 63
                       ++ RW+Pt+eQ+++L++ly+sGl  Pn ++++rit++L+ yG++++kNV yWFQNrkaR+r+
   Migut.N02641.1.p 14 SSGRWSPTQEQVMVLHALYRSGLTKPNPSQVERITSQLSLYGRVQSKNVLYWFQNRKARDRK 75
                       578*********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.0621176IPR001356Homeobox domain
SuperFamilySSF466891.54E-101279IPR009057Homeodomain-like
SMARTSM003893.7E-51380IPR001356Homeobox domain
PfamPF000464.4E-141675IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.8E-91776IPR009057Homeodomain-like
CDDcd000867.74E-41776No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MSPSRANCSS TSSSSGRWSP TQEQVMVLHA LYRSGLTKPN PSQVERITSQ LSLYGRVQSK  60
NVLYWFQNRK ARDRKNLRNK LHQQHQPQLY HHHHQLLINN YYNTTPSPFA LQLFNCFPQE  120
VTADRGRMTW TADDLPKECS IETNGQDSVR YNRKKKPLET LELFPLRPTT V*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.N02641.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012838347.11e-126PREDICTED: WUSCHEL-related homeobox 3-like
TrEMBLA0A022R7K53e-82A0A022R7K5_ERYGU; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29591951
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.14e-22WOX family protein