PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.N00362.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family MYB_related
Protein Properties Length: 301aa    MW: 33145.8 Da    PI: 10.0926
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.N00362.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13e-165695647
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +eEde +v+a++++G++ W+tIar++  gRt++ +k++w++ 
  Migut.N00362.1.p 56 PEEDETIVRAHAKFGNK-WATIARMLC-GRTDNAIKNHWNST 95
                      7****************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007172.1E-114498IPR001005SANT/Myb domain
PROSITE profilePS5129418.22445100IPR017930Myb domain
CDDcd001671.53E-114796No hitNo description
SuperFamilySSF466891.2E-1256101IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-175697IPR009057Homeodomain-like
PfamPF002491.7E-135695IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MVEGKERGCG RREEGRRWCG HPVRRRGCGA RLWRDCGEKE GRSSRRRWST ARFRAPEEDE  60
TIVRAHAKFG NKWATIARML CGRTDNAIKN HWNSTLKRKC VSMSEEFNNF DPEAQPPLKR  120
SASLGPATSA FCFNPGSPSG SDMSDSSHSG HLIYRPIART GGISQSPPDP TREPVTSLSL  180
SLPGSDPNLN SITEPIHNPI PEPDPNHALK PMMVPPKHPN QMISSLPPPP PPPAAAPPLQ  240
MHQFSPAAQP AGVVGEKQFF SAEFLAVMQE MVRKEVRNYM AGLSLSRMGS ACRQKPLEML  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mbj_A1e-145799951MYB PROTO-ONCOGENE PROTEIN
1mbk_A1e-145799951MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.N00362.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012851720.11e-154PREDICTED: transcription factor MYB44-like
TrEMBLA0A022QZ930.0A0A022QZ93_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15862471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.15e-33myb domain protein 73