PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.M01086.1.p
Common NameLOC105969033, MIMGU_mgv1a008138mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WOX
Protein Properties Length: 384aa    MW: 42382.2 Da    PI: 7.4794
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.M01086.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox52.86.7e-1759119257
                       T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                       ++R+++ +eq+ +Le+ F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k+
  Migut.M01086.1.p  59 KPRWNPRPEQIGILESIFNSgMVNPPRDEIRKIRAQLqefgQVGDANVFYWFQNRKSRSKH 119
                       89*****************99*************************************995 PP

2Wus_type_Homeobox109.81.5e-3558121265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +++RW+P+peQi iLe++++sG+++P+++ei++i+a+L+e+G+++d+NVfyWFQNrk+R+++k+
   Migut.M01086.1.p  58 PKPRWNPRPEQIGILESIFNSGMVNPPRDEIRKIRAQLQEFGQVGDANVFYWFQNRKSRSKHKH 121
                        689**********************************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.89E-1254126IPR009057Homeodomain-like
PROSITE profilePS5007110.17155120IPR001356Homeobox domain
SMARTSM003891.7E-757124IPR001356Homeobox domain
CDDcd000861.51E-758121No hitNo description
PfamPF000461.5E-1459119IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.6E-759126IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0030010Biological Processestablishment of cell polarity
GO:0048825Biological Processcotyledon development
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPCNTT THHQWQHQQH DVNSTLLSSP CTRTPFNTPG CEERTPEPKP  60
RWNPRPEQIG ILESIFNSGM VNPPRDEIRK IRAQLQEFGQ VGDANVFYWF QNRKSRSKHK  120
HRQNLHHTPK SRHPPPSAAA AAPPPSSSSS SSDKSSPNNS SEKSLSVGPI TVIDLLNSPT  180
ASVNQPFFHA NNANEFLAEP FFFPAVQQNA GATQSPPPSS ITQGFYFPDN IVADQNTVPS  240
NFLLSELMLM GHYPSSKKEE DDKLKFHQQN LSNYASTSAP PNPCLPPPFS VPSINQILQG  300
VGETVGPTRS TVFINDVCFE VGYGPFSVRE AFGDDAVLIH SSGHPVLTND WGVTLQPLQH  360
GGFYYLSRPF APPSPVDRTI DLI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.M01086.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012849210.10.0PREDICTED: WUSCHEL-related homeobox 9
TrEMBLA0A022QLA80.0A0A022QLA8_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA59422335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.12e-52homeobox-3