PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.M00028.1.p
Common NameLOC105951896, MIMGU_mgv1a005166mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family GRAS
Protein Properties Length: 495aa    MW: 55716.1 Da    PI: 7.1395
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.M00028.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS396.33.3e-1211344941374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l+++L++cA+avs++d    q+l+++l++l+s +g+p+qRl ay++e+L ar+++s+  lyk+ +p +       + l++++l++e++P++k 
  Migut.M00028.1.p 134 LKQVLIACAKAVSNDDVPTSQRLMSELRQLVSVSGEPLQRLGAYMLEGLVARVSSSGRFLYKSREPVNR------QLLSYTQLLHEACPYFKY 220
                       5799*********************************************************87777766......58999************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvlva 183
                       +++ aN aI ea++ eervHiiDf+i+qG QW++L+qa+a+Rp+gpp++RiTg+++++s    +    + +g+rL+k+A++++vpfefn    
  Migut.M00028.1.p 221 GYMSANGAIAEAMKDEERVHIIDFQIGQGSQWVPLIQAFAARPGGPPRIRITGIDDATSAyapRGSGSNIVGRRLSKLAKSFKVPFEFNS--- 310
                       ********************************************************99999999999**********************9... PP

              GRAS 184 krledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                          +  +le+L +++  +EalaVn+++ lhr++desvs      +vL++vk+l+Pkvv++veqe+++n++ F  rfle+l+yy+a+f+s++++
  Migut.M00028.1.p 311 --SSGAHLENLVTQSgqKEALAVNFAFVLHRTPDESVS------TVLRMVKRLNPKVVTLVEQELNTNTAAFYPRFLETLDYYTAMFESIDVT 395
                       ..344455777666666****************65543......699********************************************** PP

              GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpL 367
                       ++re++eri++E+++l+r++vnv+aceg er+erhetl+kW++r+++aGF++ pls+ ++ ++k l++   ++ ++vee++g+l+lgW +r L
  Migut.M00028.1.p 396 VSREDKERINMEQHCLARDVVNVIACEGGERVERHETLGKWKSRFKMAGFRQFPLSSLVNGTIKKLMESWCNR-FSVEERDGALYLGWLNRDL 487
                       *********************************************************************9977.******************* PP

              GRAS 368 vsvSaWr 374
                       v++SaW+
  Migut.M00028.1.p 488 VAASAWK 494
                       ******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.696108475IPR005202Transcription factor GRAS
PfamPF035141.1E-118134494IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 495 aa     Download sequence    Send to blast
MQASGHHSRS RMPNTLCCQP VLKFESYSPQ QCHNLNPQNS SHNFQDRFCT LESSLLIETC  60
YNSPSSVTFS PNNESSLSHQ EDANELKHKL RELENVMFGP DLDFLENYEN TLLASAEIDS  120
WRQIVEPTPR GDHLKQVLIA CAKAVSNDDV PTSQRLMSEL RQLVSVSGEP LQRLGAYMLE  180
GLVARVSSSG RFLYKSREPV NRQLLSYTQL LHEACPYFKY GYMSANGAIA EAMKDEERVH  240
IIDFQIGQGS QWVPLIQAFA ARPGGPPRIR ITGIDDATSA YAPRGSGSNI VGRRLSKLAK  300
SFKVPFEFNS SSGAHLENLV TQSGQKEALA VNFAFVLHRT PDESVSTVLR MVKRLNPKVV  360
TLVEQELNTN TAAFYPRFLE TLDYYTAMFE SIDVTVSRED KERINMEQHC LARDVVNVIA  420
CEGGERVERH ETLGKWKSRF KMAGFRQFPL SSLVNGTIKK LMESWCNRFS VEERDGALYL  480
GWLNRDLVAA SAWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-5314149326378Protein SCARECROW
5b3h_A2e-5314149325377Protein SCARECROW
5b3h_D2e-5314149325377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.M00028.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1825670.0AC182567.2 Erythranthe guttata clone MGBa-50E20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012830818.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A022RRQ60.0A0A022RRQ6_ERYGU; Uncharacterized protein
STRINGMigut.M00028.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]