PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.L01470.1.p | ||||||||
Common Name | MIMGU_mgv1a022522mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 142aa MW: 16630.8 Da PI: 6.6793 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 29 | 1.8e-09 | 85 | 118 | 22 | 55 |
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 +yp++ ++ LA+++gL+++q+ +WF N+R ++ Migut.L01470.1.p 85 WPYPTECDKIALAESTGLDQKQINNWFINQRKRH 118 59*****************************985 PP | |||||||
2 | ELK | 21.8 | 4.6e-08 | 39 | 59 | 2 | 22 |
ELK 2 LKhqLlrKYsgyLgsLkqEFs 22 LK+ L r Y+++++sLk+EFs Migut.L01470.1.p 39 LKEKLVRMYGSHISSLKHEFS 59 999999**************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51213 | 8.975 | 38 | 58 | IPR005539 | ELK domain |
SMART | SM01188 | 2.3E-4 | 38 | 59 | IPR005539 | ELK domain |
Pfam | PF03789 | 1.6E-5 | 38 | 59 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.665 | 58 | 121 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 1.38E-19 | 59 | 133 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 2.9E-11 | 60 | 125 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 3.7E-28 | 63 | 121 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 6.07E-11 | 70 | 121 | No hit | No description |
Pfam | PF05920 | 2.7E-17 | 78 | 117 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 96 | 119 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 142 aa Download sequence Send to blast |
MIEVDDVSPW SDEELSKEVD TDNIENGELT TKSSEEGQLK EKLVRMYGSH ISSLKHEFSK 60 KKKKGKLPKE ARQTLLQWWN LHCKWPYPTE CDKIALAEST GLDQKQINNW FINQRKRHWK 120 SPENMQLAVF DNLSPHFFLQ D* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.L01470.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012848063.1 | 3e-90 | PREDICTED: homeobox protein knotted-1-like 6 | ||||
Swissprot | Q84JS6 | 1e-45 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
TrEMBL | A0A022QMG1 | 5e-98 | A0A022QMG1_ERYGU; Uncharacterized protein (Fragment) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA753 | 24 | 80 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.1 | 1e-41 | KNOTTED1-like homeobox gene 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.L01470.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|