PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Migut.L01172.1.p

Organism

Mimulus guttatus

Taxonomic ID

4155

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe

Family

YABBY

Protein Properties

Length: 166aa MW: 18358.1 Da PI: 9.4086

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Migut.L01172.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	152	5.3e-47	4	151	3	163
YABBY 3 vfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesasts 95 + sse++Cyv+CnfC+t+lav +P + l+++vtv+CGhC++l ++ + +q + +++ ++++l s +k +s+s Migut.L01172.1.p 4 LAPSSEHLCYVRCNFCTTVLAVGIPCKRLMETVTVKCGHCSNLSFLTTKPPVQGQC------------FDQQTILHHQSLCSEFKKGGLPSSS 84 6789***********************************986655444433333............3334445556666666666666666 PP YABBY 96 vsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163 ss++ + + +pr+p v++PPek+ r Psaynrf+keei+rik++nP+i hreafs+aaknWa + Migut.L01172.1.p 85 SSSTST-STDPSLSPRAPFVVKPPEKKHRLPSAYNRFMKEEIKRIKTANPEIPHREAFSTAAKNWARY 151 666443.344567899999*********************************************76 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	1.4E-54	7	151	IPR006780	YABBY protein
SuperFamily	SSF47095	1.57E-8	96	149	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	2.9E-5	105	150	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010254	Biological Process	nectary development
GO:0010582	Biological Process	floral meristem determinacy
GO:0048479	Biological Process	style development

Sequence ? help Back to Top
Protein Sequence Length: 166 aa Download sequence Send to blast
MDHLAPSSEH LCYVRCNFCT TVLAVGIPCK RLMETVTVKC GHCSNLSFLT TKPPVQGQCF 60 DQQTILHHQS LCSEFKKGGL PSSSSSSTST STDPSLSPRA PFVVKPPEKK HRLPSAYNRF 120 MKEEIKRIKT ANPEIPHREA FSTAAKNWAR YIPNSTEAEA RVIKP*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for the initiation of nectary development. Also involved in suppressing early radial growth of the gynoecium, in promoting its later elongation and in fusion of its carpels by regulating both cell division and expansion. Establishes the polar differentiation in the carpels by specifying abaxial cell fate in the ovary wall. Regulates both cell division and expansion. {ECO:0000269\|PubMed:10225997, ECO:0000269\|PubMed:10225998, ECO:0000269\|PubMed:10535738, ECO:0000269\|PubMed:11714690, ECO:0000269\|PubMed:15598802, ECO:0000269\|Ref.10}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00220	DAP	Transfer from AT1G69180	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Migut.L01172.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by SPT and by A class genes AP2 and LUG in the outer whorl. In the third whorl, B class genes AP3 and PI, and the C class gene AG act redundantly with each other and in combination with SEP1, SEP2, SEP3, SHP1 and SHP2 to activate CRC in nectaries and carpels. LFY enhances its expression. {ECO:0000269\|PubMed:10225998, ECO:0000269\|PubMed:15598802}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012847547.1	1e-120	PREDICTED: protein CRABS CLAW
Swissprot	Q8L925	9e-60	CRC_ARATH; Protein CRABS CLAW
TrEMBL	A0A022QNK5	5e-84	A0A022QNK5_ERYGU; Uncharacterized protein (Fragment)
STRING	Migut.L01172.1.p	1e-120	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA5210	23	39

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69180.1	8e-61	YABBY family protein

Link Out ? help Back to Top
Phytozome	Migut.L01172.1.p

Publications ? help Back to Top
Fourquin C,Primo A,Martínez-Fernández I,Huet-Trujillo E,Ferrándiz C The CRC orthologue from Pisum sativum shows conserved functions in carpel morphogenesis and vascular development. Ann. Bot., 2014. 114(7): p. 1535-44 [PMID:24989787] Pfannebecker KC,Lange M,Rupp O,Becker A Seed Plant-Specific Gene Lineages Involved in Carpel Development. Mol. Biol. Evol., 2017. 34(4): p. 925-942 [PMID:28087776] Yamaguchi N,Huang J,Xu Y,Tanoi K,Ito T Fine-tuning of auxin homeostasis governs the transition from floral stem cell maintenance to gynoecium formation. Nat Commun, 2017. 8(1): p. 1125 [PMID:29066759] Yamaguchi N, et al. Chromatin-mediated feed-forward auxin biosynthesis in floral meristem determinacy. Nat Commun, 2018. 9(1): p. 5290 [PMID:30538233]