PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.L00509.1.p
Common NameMIMGU_mgv1a024740mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family MYB
Protein Properties Length: 107aa    MW: 12509.1 Da    PI: 10.679
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.L00509.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.64.5e-111139129
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIar 29
                      +g+W+teEdell ++v+++G+++W+ I r
  Migut.L00509.1.p 11 KGPWSTEEDELLNKLVERHGTRNWSFICR 39
                      79***********************9987 PP

2Myb_DNA-binding45.32.1e-144486347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      ++T+eEde +++a++++G++ W++I+r +  + t + +k++w++ 
  Migut.L00509.1.p 44 PFTAEEDETILKAHAEFGNK-WASISRLLV-RHTYNAIKNHWNST 86
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-9839IPR009057Homeodomain-like
SuperFamilySSF466891.41E-19883IPR009057Homeodomain-like
PfamPF002496.5E-91138IPR001005SANT/Myb domain
CDDcd001672.64E-51340No hitNo description
PROSITE profilePS5129420.6353791IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-174190IPR009057Homeodomain-like
SMARTSM007173.7E-124189IPR001005SANT/Myb domain
CDDcd001676.27E-84487No hitNo description
PfamPF002492.0E-124486IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 107 aa     Download sequence    Send to blast
MAAEEVRDRI KGPWSTEEDE LLNKLVERHG TRNWSFICRF RHRPFTAEED ETILKAHAEF  60
GNKWASISRL LVRHTYNAIK NHWNSTLKRK FAADVAAGRR SDGRRF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-216912108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.L00509.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012834031.11e-47PREDICTED: transcription factor MYB44-like
SwissprotQ9SN123e-34MYB77_ARATH; Transcription factor MYB77
TrEMBLA0A022QGY05e-72A0A022QGY0_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15862471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.11e-36myb domain protein 77
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]