PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.L00509.1.p | ||||||||
Common Name | MIMGU_mgv1a024740mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 107aa MW: 12509.1 Da PI: 10.679 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 34.6 | 4.5e-11 | 11 | 39 | 1 | 29 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIar 29 +g+W+teEdell ++v+++G+++W+ I r Migut.L00509.1.p 11 KGPWSTEEDELLNKLVERHGTRNWSFICR 39 79***********************9987 PP | |||||||
2 | Myb_DNA-binding | 45.3 | 2.1e-14 | 44 | 86 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++T+eEde +++a++++G++ W++I+r + + t + +k++w++ Migut.L00509.1.p 44 PFTAEEDETILKAHAEFGNK-WASISRLLV-RHTYNAIKNHWNST 86 89******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.6E-9 | 8 | 39 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.41E-19 | 8 | 83 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 6.5E-9 | 11 | 38 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.64E-5 | 13 | 40 | No hit | No description |
PROSITE profile | PS51294 | 20.635 | 37 | 91 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.0E-17 | 41 | 90 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.7E-12 | 41 | 89 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.27E-8 | 44 | 87 | No hit | No description |
Pfam | PF00249 | 2.0E-12 | 44 | 86 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 107 aa Download sequence Send to blast |
MAAEEVRDRI KGPWSTEEDE LLNKLVERHG TRNWSFICRF RHRPFTAEED ETILKAHAEF 60 GNKWASISRL LVRHTYNAIK NHWNSTLKRK FAADVAAGRR SDGRRF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-21 | 6 | 91 | 2 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.L00509.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012834031.1 | 1e-47 | PREDICTED: transcription factor MYB44-like | ||||
Swissprot | Q9SN12 | 3e-34 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | A0A022QGY0 | 5e-72 | A0A022QGY0_ERYGU; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1586 | 24 | 71 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50060.1 | 1e-36 | myb domain protein 77 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.L00509.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|