PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.L00355.1.p
Common NameLOC105964135, MIMGU_mgv1a025465mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WOX
Protein Properties Length: 322aa    MW: 37070.1 Da    PI: 9.7694
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.L00355.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox72.93.7e-2367126357
                       --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                       +R+++t+eql++Lee++++ +r+psae+++++A+kl    +++ ++V++WFqN++a+e++
  Migut.L00355.1.p  67 TRWNPTPEQLQALEEMYKRgTRTPSAEQIQQIAAKLrrfgKIEGKNVFYWFQNHKARERQ 126
                       8*****************99**************************************97 PP

2Wus_type_Homeobox114.94e-3766128365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +tRW+PtpeQ++ Lee+yk+G+rtP++e+iq+i+a+L+++Gkie+kNVfyWFQN+kaRerqk+
   Migut.L00355.1.p  66 STRWNPTPEQLQALEEMYKRGTRTPSAEQIQQIAAKLRRFGKIEGKNVFYWFQNHKARERQKK 128
                        79***********************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003895.1E-764131IPR001356Homeobox domain
SuperFamilySSF466893.15E-1466132IPR009057Homeodomain-like
CDDcd000867.81E-867128No hitNo description
PfamPF000469.2E-2167126IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.2E-1067126IPR009057Homeodomain-like
PROSITE profilePS5007111.98572127IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MWMAEADRKL RPLMPRPISS CSHFSTISNP SCCCIHNPNI LPWNHQISGM SEYGVKREIQ  60
TMPLVSTRWN PTPEQLQALE EMYKRGTRTP SAEQIQQIAA KLRRFGKIEG KNVFYWFQNH  120
KARERQKKRR QLDLQLHPAR KNQTGLMSRR YFEIEHHKKL STPSNCSAPN SEDSAASMQY  180
GTAIAECKKD EWTHLRQNKI NVTTAKNESS CWKLDTILHT AAQNPALERE HNNHKPPFAT  240
TTTNSSLNLS ILLSPKIDDI NFLEDEKSSS LTETTRETRT LLQLFPIRST DLGTREEVGI  300
RDISTRFTPN HQFIEFLPTK N*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.L00355.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012844100.10.0PREDICTED: WUSCHEL-related homeobox 6-like
TrEMBLA0A022QW660.0A0A022QW66_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46812342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.13e-38WUSCHEL related homeobox 1