PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.K00205.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WOX
Protein Properties Length: 237aa    MW: 25032.8 Da    PI: 7.1768
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.K00205.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.64.4e-089403057
                      HHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox 30 reeLAkkl....gLterqVkvWFqNrRakekk 57
                        ++ k l    ++ +++V++WFqNrR + ++
  Migut.K00205.1.p  9 TVKIRKLLekfgSVGDANVFYWFQNRRSRSRR 40
                      5555555555578999*************997 PP

2Wus_type_Homeobox61.81.5e-201422465
  Wus_type_Homeobox 24 lrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +++P+k+e+ +i++ Le++G ++d+NVfyWFQNr++R+r++q
   Migut.K00205.1.p  1 MVNPPKDETVKIRKLLEKFGSVGDANVFYWFQNRRSRSRRRQ 42
                       78**************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500718.892141IPR001356Homeobox domain
SuperFamilySSF466891.31E-7447IPR009057Homeodomain-like
PfamPF000461.4E-5840IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.7E-51545IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MVNPPKDETV KIRKLLEKFG SVGDANVFYW FQNRRSRSRR RQRQMQAGLC GGGGGEHQQQ  60
AQPRGGGSNG GYSGGGGIHY ENLLSGGGGG LVAPNNHPVI SYTSSNCVVG SSSSSSSCGF  120
DGNIINGKNN SSDDLFLFSG HPGSVQDYDP NPGFCFAGGA STLNYQPEVI TVFINGVATE  180
IGRGAVDMKA VFGGDFVLFH SSGVPVQVNE YGFLLQSLQH GESYFLVIIS LFHLIN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.K00205.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012857238.11e-171PREDICTED: WUSCHEL-related homeobox 11-like isoform X1
TrEMBLA0A022PWX31e-117A0A022PWX3_ERYGU; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61662231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.12e-25WUSCHEL related homeobox 11