PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.J01603.1.p
Common NameMIMGU_mgv1a025797mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WOX
Protein Properties Length: 210aa    MW: 23110.4 Da    PI: 6.4181
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.J01603.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.93.1e-172282257
                      T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                      r+R+t+++eq+e+Le+lF+  + +p ++e  ++ k l     + +++V++WFqNrR + ++
  Migut.J01603.1.p 22 RSRWTPKPEQIEILESLFNGgTVNPHRDETVRIRKMLqkfgPVGDANVFYWFQNRRSRSRR 82
                      89*****************99****************99999****************997 PP

2Wus_type_Homeobox104.56.9e-342184265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       ar+RWtP+peQi+iLe+l++ G+++P ++e+ ri+++L+++G ++d+NVfyWFQNr++R+r++q
   Migut.J01603.1.p 21 ARSRWTPKPEQIEILESLFNGGTVNPHRDETVRIRKMLQKFGPVGDANVFYWFQNRRSRSRRRQ 84
                       689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-101887IPR009057Homeodomain-like
PROSITE profilePS5007111.6771883IPR001356Homeobox domain
SuperFamilySSF466891.2E-141889IPR009057Homeodomain-like
SMARTSM003893.9E-72087IPR001356Homeobox domain
PfamPF000466.5E-152282IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048830Biological Processadventitious root development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MEDQEQDIGS GRSHGSEAEP ARSRWTPKPE QIEILESLFN GGTVNPHRDE TVRIRKMLQK  60
FGPVGDANVF YWFQNRRSRS RRRQRQLQAT LTAAAADQQP QAGGGGVGHH QYHENTISST  120
TTSGFSGSSS SFGLGGTDYL GPNDTSNLHY QSEGLITVFI NGVATEVTKG PLNVKAMFGG  180
DYLLFHCSGM PVDEVYDHGF LVQHGESYFL
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.J01603.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012839514.11e-156PREDICTED: WUSCHEL-related homeobox 6-like
SwissprotQ8GY258e-47WOX12_ARATH; WUSCHEL-related homeobox 12
TrEMBLA0A022R5X11e-155A0A022R5X1_ERYGU; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61662231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17810.28e-31WUSCHEL related homeobox 12
Publications ? help Back to Top
  1. Hu X,Xu L
    Transcription Factors WOX11/12 Directly Activate WOX5/7 to Promote Root Primordia Initiation and Organogenesis.
    Plant Physiol., 2016. 172(4): p. 2363-2373
    [PMID:27784768]