PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.J00446.1.p | ||||||||
Common Name | LOC105952772, MIMGU_mgv1a020315mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 206aa MW: 23790.6 Da PI: 4.5735 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 47.8 | 3.4e-15 | 8 | 55 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W +eEde+l av+ +G ++W++ a+ g++R +k+c++rw +yl Migut.J00446.1.p 8 KGPWLEEEDEQLSAAVAVFGDKRWDALAKSSGLRRNGKSCRLRWMNYL 55 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 52.3 | 1.3e-16 | 62 | 106 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g+ +++E+ +++++++++G++ W+ Iar+++ gRt++++k++w++yl Migut.J00446.1.p 62 GNISADEERIIIQLHEKWGNK-WSMIARRLP-GRTDNEIKNYWRSYL 106 67799****************.*********.*************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.278 | 1 | 55 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.25E-28 | 5 | 102 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.8E-13 | 7 | 57 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.7E-13 | 8 | 55 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.4E-21 | 9 | 62 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.22E-9 | 10 | 55 | No hit | No description |
PROSITE profile | PS51294 | 26.5 | 56 | 110 | IPR017930 | Myb domain |
SMART | SM00717 | 9.2E-16 | 60 | 108 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-14 | 62 | 106 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.5E-24 | 63 | 109 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.32E-11 | 65 | 106 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 206 aa Download sequence Send to blast |
MQEVELRKGP WLEEEDEQLS AAVAVFGDKR WDALAKSSGL RRNGKSCRLR WMNYLRPNLK 60 HGNISADEER IIIQLHEKWG NKWSMIARRL PGRTDNEIKN YWRSYLKKKA LALDKECLSS 120 TTNTCLRSEE CETDSPCSVN DEIVGPTTDS SDALDIMLNM TSSPYETRLT EWMMSSNCDK 180 DEFSNYDLCF SDDYATWDFS LWDGE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 5e-28 | 5 | 110 | 1 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h88_C | 2e-27 | 5 | 110 | 55 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 2e-27 | 5 | 110 | 55 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h8a_C | 1e-27 | 5 | 110 | 24 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00406 | DAP | Transfer from AT3G53200 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.J00446.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates in etiolated seedlings in dark conditions. {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012831805.1 | 1e-151 | PREDICTED: myb-related protein MYBAS2-like | ||||
Swissprot | Q9SCP1 | 4e-52 | MYB27_ARATH; Transcription factor MYB27 | ||||
TrEMBL | A0A022RNP1 | 1e-149 | A0A022RNP1_ERYGU; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53200.1 | 1e-54 | myb domain protein 27 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.J00446.1.p |
Entrez Gene | 105952772 |
Publications ? help Back to Top | |||
---|---|---|---|
|