PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.I00308.1.p
Common NameMIMGU_mgv1a026259mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WOX
Protein Properties Length: 271aa    MW: 29949.8 Da    PI: 4.8674
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.I00308.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.41.9e-212584357
                      --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                      +R+++t eq+++Leel+++ +r+psae++++++++l    +++ ++V++WFqN++a+e++
  Migut.I00308.1.p 25 TRWNPTLEQIQTLEELYRRgTRTPSAEQIQHITAQLrrygKIEGKNVFYWFQNHKARERQ 84
                      8*****************99**************************************97 PP

2Wus_type_Homeobox114.94e-372486365
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +tRW+Pt eQi+ Leely++G+rtP++e+iq+ita+L++yGkie+kNVfyWFQN+kaRerqk+
   Migut.I00308.1.p 24 STRWNPTLEQIQTLEELYRRGTRTPSAEQIQHITAQLRRYGKIEGKNVFYWFQNHKARERQKR 86
                       79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.8E-42289IPR001356Homeobox domain
SuperFamilySSF466894.19E-112589IPR009057Homeodomain-like
CDDcd000869.08E-72586No hitNo description
PfamPF000464.8E-192584IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.7E-82684IPR009057Homeodomain-like
PROSITE profilePS5007110.8843085IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGGGDRNKRE LNNGGATKQQ VVVSTRWNPT LEQIQTLEEL YRRGTRTPSA EQIQHITAQL  60
RRYGKIEGKN VFYWFQNHKA RERQKRRRQL DHDQVVDEPP THNYSTQFTH HVQNKESSSP  120
EENGTVIFEV EESKNWASPT NSISTILAEK NVATQGAEAA AAADAECKSD GWLQFDHAQR  180
NATCHIISSP YPPVSTCIEP CILENFDHSA AAAGGSGGDA QTLQLFPLGS GGGGCEDDKE  240
EEEESGGAAM NDISDDVIPY QFFEFLPLKN *
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.I00308.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012841517.10.0PREDICTED: WUSCHEL-related homeobox 1-like
TrEMBLA0A022R2060.0A0A022R206_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46812342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.18e-38WUSCHEL related homeobox 1