PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.H02206.1.p
Common NameLOC105965319, MIMGU_mgv1a011688mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WOX
Protein Properties Length: 275aa    MW: 30603.9 Da    PI: 4.911
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.H02206.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.71.3e-2090150257
                       T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                       r+R+t+t+ ql++Le+ F +   +ps++++++++++l    +++e++V++WFqNrRa+ k+
  Migut.H02206.1.p  90 RQRWTPTPMQLQILERIFDQgVGTPSKQKIKDITTELsqhgQISETNVYNWFQNRRARSKR 150
                       89*****************99**************************************97 PP

2Wus_type_Homeobox104.38.2e-3490152365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        r+RWtPtp Q++iLe+++++G+ tP+k++i++it+eL+++G+i+++NV++WFQNr+aR+++kq
   Migut.H02206.1.p  90 RQRWTPTPMQLQILERIFDQGVGTPSKQKIKDITTELSQHGQISETNVYNWFQNRRARSKRKQ 152
                        89***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-1685158IPR009057Homeodomain-like
PROSITE profilePS5007114.10786151IPR001356Homeobox domain
SMARTSM003891.3E-1388155IPR001356Homeobox domain
SuperFamilySSF466892.22E-1788154IPR009057Homeodomain-like
PfamPF000462.0E-1890150IPR001356Homeobox domain
CDDcd000866.85E-1290152No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MMEWEKQPPQ QAEEPSGGGG GGGGGMYVKV MTDEQMEVLR KQIAVYATIC EQLVELHKTL  60
TSQNDLSGVR LGNLYCDPLM TSGAHKITGR QRWTPTPMQL QILERIFDQG VGTPSKQKIK  120
DITTELSQHG QISETNVYNW FQNRRARSKR KQHAPQSNNN NNGESEVETE VESSNEKKTN  180
TDESFQPQNI LSSNSEDLCF QNPQSSSAVD PRTSKAEPTL PQEVSSKFGG GFGQMPSFYG  240
SMLPNSRMEQ FIGKIEVPGN YNPYLQQDDY NIDG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1143151RRARSKRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00617PBMTransfer from AT4G35550Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.H02206.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012845314.10.0PREDICTED: WUSCHEL-related homeobox 8
SwissprotQ5QMM31e-85WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLA0A022QQ640.0A0A022QQ64_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA56752437
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.12e-79WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]