PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.H01617.1.p
Common NameLOC105962196, MIMGU_mgv1a005915mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family GRAS
Protein Properties Length: 466aa    MW: 52301.1 Da    PI: 5.9488
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.H01617.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS402.54.2e-123904651374
              GRAS   1 lvelLlecAeavssgdlela....qalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                       l++lL++cAe +s +d ++a    +alL  l++++s  gdp+qRl ay++e+L+arl++s+s +yk+l+++e +   sse ++++++++e++P
  Migut.H01617.1.p  90 LKQLLVACAETISYSDGKMAvstfEALLRILEKRVSVCGDPLQRLGAYMLEGLRARLLSSGSIIYKKLKCREPT---SSELMSYMQVLYEICP 179
                       689***********99887634436788999999***************************************9...9*************** PP

              GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                       ++kf+++ aN  I ea+++e+r+HiiDf+i qG QW++++q +++Rp+gpp +RiTgv+++es   +   l  +g+rLa++Ae++gv+fefn 
  Migut.H01617.1.p 180 YYKFAYISANVVIEEAMQNEKRIHIIDFQIAQGSQWVSFIQDISCRPGGPPCVRITGVDDSESAhaRGGGLDLVGRRLAQVAESCGVHFEFNG 272
                       ************************************************************9888889999*********************** PP

              GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                        ++++ e    ++L++++gEalaV++ + lh+++desvs+ ++rd++L+lvk+lsPkv++++eqe+++n+++Fl+rf e+l+yy+ +f+s++a
  Migut.H01617.1.p 273 AAMSENEVELCNNLEIRNGEALAVSFPYVLHHIPDESVSTLNQRDRLLRLVKGLSPKVLTLAEQESNTNTSTFLQRFYETLDYYTNMFESIDA 365
                       766666666689********************************************************************************* PP

              GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                         +re+++ri+ E++++++++vn++aceg++r+erhe ++kW+ rl++aGF+++pls+++ ++++ +l  ++++ yrv e +g+l+l Wk+r+
  Migut.H01617.1.p 366 ARSREDRQRINAEEHCVAKDVVNIIACEGDDRVERHELFGKWKLRLTMAGFTQMPLSSSVSDSIRVMLGGYSWN-YRVVEGNGALYLAWKNRA 457
                       *9**********************************************************************66.****************** PP

              GRAS 367 LvsvSaWr 374
                       Lv++SaWr
  Migut.H01617.1.p 458 LVTASAWR 465
                       *******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.70764446IPR005202Transcription factor GRAS
PfamPF035141.4E-12090465IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MQEPQTYHQT IKPYYFSNQF YTLESTPPTC NNATHSSASS ASISSNRSPF SPQLHHSSDN  60
NTYEVVGPEC DIDHSPSFNR ILEIAPQMDL KQLLVACAET ISYSDGKMAV STFEALLRIL  120
EKRVSVCGDP LQRLGAYMLE GLRARLLSSG SIIYKKLKCR EPTSSELMSY MQVLYEICPY  180
YKFAYISANV VIEEAMQNEK RIHIIDFQIA QGSQWVSFIQ DISCRPGGPP CVRITGVDDS  240
ESAHARGGGL DLVGRRLAQV AESCGVHFEF NGAAMSENEV ELCNNLEIRN GEALAVSFPY  300
VLHHIPDESV STLNQRDRLL RLVKGLSPKV LTLAEQESNT NTSTFLQRFY ETLDYYTNMF  360
ESIDAARSRE DRQRINAEEH CVAKDVVNII ACEGDDRVER HELFGKWKLR LTMAGFTQMP  420
LSSSVSDSIR VMLGGYSWNY RVVEGNGALY LAWKNRALVT ASAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A8e-569746426378Protein SCARECROW
5b3h_A6e-569746425377Protein SCARECROW
5b3h_D6e-569746425377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a positive regulator of continuous red light signals downstream of phytochrome B (phyB). Required for the regulation of hypocotyl elongation during de-etiolation. May be required to modulate phytochrome A (phyA) signal transduction in a phyB-independent way. {ECO:0000269|PubMed:16680434}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.H01617.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By osmotic and cold stresses, and UV-A/B. {ECO:0000269|PubMed:16680434}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012841950.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M51e-174SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A022R0T10.0A0A022R0T1_ERYGU; Uncharacterized protein
STRINGMigut.H01617.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.11e-160SCARECROW-like 13