PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.H01397.2.p | ||||||||
Common Name | MIMGU_mgv1a017292mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 84aa MW: 9678 Da PI: 9.869 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 102.3 | 1.7e-32 | 30 | 80 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++g+lyeys+ Migut.H01397.2.p 30 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYSN 80 79***********************************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.4E-40 | 22 | 81 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.333 | 22 | 82 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.43E-36 | 23 | 81 | No hit | No description |
SuperFamily | SSF55455 | 4.32E-30 | 23 | 81 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 24 | 78 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.3E-33 | 24 | 44 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.0E-27 | 31 | 78 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.3E-33 | 44 | 59 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.3E-33 | 59 | 80 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 84 aa Download sequence Send to blast |
MEIIQSEESN SREISSSERK SIGRGKIEIK RIENTTNRQV TFCKRRNGLL KKAYELSVLC 60 DAEVALIVFS TRGRLYEYSN NRY* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-20 | 22 | 80 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-20 | 22 | 80 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-20 | 22 | 80 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-20 | 22 | 80 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_A | 1e-20 | 22 | 80 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-20 | 22 | 80 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-20 | 22 | 80 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-20 | 22 | 80 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-20 | 22 | 80 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-20 | 22 | 80 | 1 | 59 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.H01397.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007146364.1 | 1e-38 | hypothetical protein PHAVU_006G034400g | ||||
Refseq | XP_018450192.1 | 1e-37 | PREDICTED: floral homeotic protein AGAMOUS-like isoform X1 | ||||
Refseq | XP_018450193.1 | 1e-37 | PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 | ||||
Refseq | XP_018450194.1 | 1e-37 | PREDICTED: floral homeotic protein AGAMOUS-like isoform X3 | ||||
Refseq | XP_018450196.1 | 1e-37 | PREDICTED: floral homeotic protein AGAMOUS-like isoform X4 | ||||
Refseq | XP_018450197.1 | 1e-37 | PREDICTED: floral homeotic protein AGAMOUS-like isoform X5 | ||||
Refseq | XP_018450198.1 | 1e-37 | PREDICTED: floral homeotic protein AGAMOUS-like isoform X6 | ||||
Refseq | XP_028062146.1 | 8e-38 | floral homeotic protein AGAMOUS-like | ||||
Swissprot | P29385 | 3e-37 | AGL5_ARATH; Agamous-like MADS-box protein AGL5 | ||||
TrEMBL | A0A022RS11 | 2e-51 | A0A022RS11_ERYGU; Uncharacterized protein |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G58780.2 | 5e-39 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.H01397.2.p |