PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Migut.H01397.2.p

Common Name

MIMGU_mgv1a017292mg

Organism

Mimulus guttatus

Taxonomic ID

4155

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe

Family

M-type_MADS

Protein Properties

Length: 84aa MW: 9678 Da PI: 9.869

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Migut.H01397.2.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	102.3	1.7e-32	30	80	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++g+lyeys+ Migut.H01397.2.p 30 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYSN 80 79***********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	2.4E-40	22	81	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.333	22	82	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.43E-36	23	81	No hit	No description
SuperFamily	SSF55455	4.32E-30	23	81	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	24	78	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.3E-33	24	44	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.0E-27	31	78	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.3E-33	44	59	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.3E-33	59	80	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 84 aa Download sequence Send to blast
MEIIQSEESN SREISSSERK SIGRGKIEIK RIENTTNRQV TFCKRRNGLL KKAYELSVLC 60 DAEVALIVFS TRGRLYEYSN NRY*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	1e-20	22	80	1	59	Myocyte-specific enhancer factor 2B
1tqe_Q	1e-20	22	80	1	59	Myocyte-specific enhancer factor 2B
1tqe_R	1e-20	22	80	1	59	Myocyte-specific enhancer factor 2B
1tqe_S	1e-20	22	80	1	59	Myocyte-specific enhancer factor 2B
6c9l_A	1e-20	22	80	1	59	Myocyte-specific enhancer factor 2B
6c9l_B	1e-20	22	80	1	59	Myocyte-specific enhancer factor 2B
6c9l_C	1e-20	22	80	1	59	Myocyte-specific enhancer factor 2B
6c9l_D	1e-20	22	80	1	59	Myocyte-specific enhancer factor 2B
6c9l_E	1e-20	22	80	1	59	Myocyte-specific enhancer factor 2B
6c9l_F	1e-20	22	80	1	59	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269\|PubMed:27776173}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Migut.H01397.2.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007146364.1	1e-38	hypothetical protein PHAVU_006G034400g
Refseq	XP_018450192.1	1e-37	PREDICTED: floral homeotic protein AGAMOUS-like isoform X1
Refseq	XP_018450193.1	1e-37	PREDICTED: floral homeotic protein AGAMOUS-like isoform X2
Refseq	XP_018450194.1	1e-37	PREDICTED: floral homeotic protein AGAMOUS-like isoform X3
Refseq	XP_018450196.1	1e-37	PREDICTED: floral homeotic protein AGAMOUS-like isoform X4
Refseq	XP_018450197.1	1e-37	PREDICTED: floral homeotic protein AGAMOUS-like isoform X5
Refseq	XP_018450198.1	1e-37	PREDICTED: floral homeotic protein AGAMOUS-like isoform X6
Refseq	XP_028062146.1	8e-38	floral homeotic protein AGAMOUS-like
Swissprot	P29385	3e-37	AGL5_ARATH; Agamous-like MADS-box protein AGL5
TrEMBL	A0A022RS11	2e-51	A0A022RS11_ERYGU; Uncharacterized protein

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G58780.2	5e-39	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	Migut.H01397.2.p

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Pabón-Mora N,Wong GK,Ambrose BA Evolution of fruit development genes in flowering plants. Front Plant Sci, 2014. 5: p. 300 [PMID:25018763] Rathnakumar K, et al. Angiopoietin-2 mediates thrombin-induced monocyte adhesion and endothelial permeability. J. Thromb. Haemost., 2016. 14(8): p. 1655-67 [PMID:27241812] Balanzà V,Roig-Villanova I,Di Marzo M,Masiero S,Colombo L Seed abscission and fruit dehiscence required for seed dispersal rely on similar genetic networks. Development, 2016. 143(18): p. 3372-81 [PMID:27510967] Ehlers K, et al. The MADS Box Genes ABS, SHP1, and SHP2 Are Essential for the Coordination of Cell Divisions in Ovule and Seed Coat Development and for Endosperm Formation in Arabidopsis thaliana. PLoS ONE, 2016. 11(10): p. e0165075 [PMID:27776173] Sehra B,Franks RG Redundant CArG Box Cis-motif Activity Mediates SHATTERPROOF2 Transcriptional Regulation during Arabidopsis thaliana Gynoecium Development. Front Plant Sci, 2017. 8: p. 1712 [PMID:29085379] Ó'Maoiléidigh DS,Stewart D,Zheng B,Coupland G,Wellmer F Floral homeotic proteins modulate the genetic program for leaf development to suppress trichome formation in flowers. Development, 2018. [PMID:29361563]