PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.H00081.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 162aa MW: 17625.8 Da PI: 8.2008 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 137.4 | 5.2e-43 | 11 | 109 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 +CaaCk+lrrkC ++C++apyfpaeqp kf vhk+FGasnv kll+++p+++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++e Migut.H00081.1.p 11 PCAACKFLRRKCLPGCTFAPYFPAEQPTKFVHVHKIFGASNVGKLLNEIPPHQREDAVNSLAYEAEARLNDPVYGCVGAISVLQRQVFNLQKE 103 7******************************************************************************************** PP DUF260 94 lallke 99 l+++++ Migut.H00081.1.p 104 LDATNA 109 *99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.606 | 10 | 111 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.0E-42 | 11 | 108 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MASSSSSNPA PCAACKFLRR KCLPGCTFAP YFPAEQPTKF VHVHKIFGAS NVGKLLNEIP 60 PHQREDAVNS LAYEAEARLN DPVYGCVGAI SVLQRQVFNL QKELDATNAD IIRYAASRTN 120 SNNDWRIDPD GSGYFDPNSG LFLPYYWSGG GGAAPPSRRD R* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-61 | 10 | 115 | 10 | 115 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-61 | 10 | 115 | 10 | 115 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.H00081.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012850821.1 | 1e-118 | PREDICTED: protein LATERAL ORGAN BOUNDARIES | ||||
Swissprot | Q9FML4 | 2e-61 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A2R6RTM5 | 1e-68 | A0A2R6RTM5_ACTCH; Protein LATERAL ORGAN BOUNDARIES like | ||||
TrEMBL | A0A2R6RYX5 | 1e-68 | A0A2R6RYX5_ACTCH; Protein LATERAL ORGAN BOUNDARIES like | ||||
STRING | Migut.H00081.1.p | 1e-117 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA43 | 24 | 669 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27650.1 | 2e-56 | LOB domain-containing protein 25 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.H00081.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|