PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.F01796.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 165aa MW: 17706.7 Da PI: 6.5351 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 174.2 | 1.3e-54 | 26 | 121 | 1 | 96 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 vreqdrflPian++rimkk+lP+n+ki+kdak+tvqecvsefi+f+tseas+kcq+ekrktingddll+a+atlGfedy++plkvyl++yrel Migut.F01796.1.p 26 VREQDRFLPIANIGRIMKKALPTNGKIGKDAKDTVQECVSEFIGFITSEASNKCQKEKRKTINGDDLLYAIATLGFEDYIAPLKVYLARYREL 118 69******************************************************************************************* PP NF-YB 94 ege 96 eg+ Migut.F01796.1.p 119 EGD 121 *98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 7.8E-50 | 24 | 143 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.42E-38 | 29 | 141 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.2E-25 | 32 | 96 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.7E-18 | 60 | 78 | No hit | No description |
PRINTS | PR00615 | 2.7E-18 | 79 | 97 | No hit | No description |
PRINTS | PR00615 | 2.7E-18 | 98 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MADSPGGDGS HEGGGGGGDR SPRLGVREQD RFLPIANIGR IMKKALPTNG KIGKDAKDTV 60 QECVSEFIGF ITSEASNKCQ KEKRKTINGD DLLYAIATLG FEDYIAPLKV YLARYRELEG 120 DIKGPGKGAD GSSKKETRQV SDSQFVHQGS VSQGFSYSNP EIEY* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-45 | 26 | 117 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-45 | 26 | 117 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.F01796.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012834891.1 | 1e-117 | PREDICTED: nuclear transcription factor Y subunit B-1-like | ||||
Refseq | XP_012834892.1 | 1e-117 | PREDICTED: nuclear transcription factor Y subunit B-1-like | ||||
Swissprot | Q8VYK4 | 1e-70 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A0N6X6V5 | 3e-88 | A0A0N6X6V5_SALMI; Transcription factor NFYB | ||||
STRING | Migut.F01796.1.p | 1e-117 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53340.1 | 1e-67 | nuclear factor Y, subunit B10 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.F01796.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|