PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.F01545.1.p | ||||||||
Common Name | MIMGU_mgv1a015679mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 150aa MW: 17188.6 Da PI: 8.9373 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 45.7 | 1.5e-14 | 39 | 83 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 g+W Ede+l av+++G ++W++I++ + R++kqck rw++ Migut.F01545.1.p 39 GAWKNTEDEILTAAVNKYGENQWSKISSLLV-PRSPKQCKARWYDC 83 79*****************************.9**********975 PP | |||||||
2 | Myb_DNA-binding | 33.2 | 1.2e-10 | 92 | 133 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 WT+eEde+l+++ k++++ W+tIa + R + qc +r+ k+ Migut.F01545.1.p 92 EWTQEEDEKLLCLAKLMPKQ-WRTIAPIVE--RPPSQCLERYKKL 133 7*****************99.********9..**********997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 23.046 | 33 | 88 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.67E-20 | 36 | 118 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.0E-13 | 37 | 86 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.1E-21 | 39 | 91 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.81E-12 | 40 | 81 | No hit | No description |
Pfam | PF13921 | 8.6E-16 | 41 | 101 | No hit | No description |
CDD | cd11659 | 3.07E-25 | 86 | 135 | No hit | No description |
SMART | SM00717 | 1.6E-11 | 89 | 136 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 12.914 | 89 | 138 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.5E-13 | 92 | 136 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
MENTFTPRTP PESRSAIEAF RKGKLRNPRK KERSNIMGGA WKNTEDEILT AAVNKYGENQ 60 WSKISSLLVP RSPKQCKARW YDCLDPSINT TEWTQEEDEK LLCLAKLMPK QWRTIAPIVE 120 RPPSQCLERY KKLVDPTGAT DENPVLLQD* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3jb9_W | 5e-47 | 36 | 147 | 4 | 115 | Pre-mRNA-splicing factor cdc5 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250|UniProtKB:Q99459, ECO:0000269|PubMed:17298883, ECO:0000269|PubMed:17575050, ECO:0000269|PubMed:8917598}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.F01545.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012842448.1 | 6e-79 | PREDICTED: cell division cycle 5-like protein isoform X1 | ||||
Swissprot | P92948 | 2e-49 | CDC5L_ARATH; Cell division cycle 5-like protein | ||||
TrEMBL | A0A022QZR3 | 1e-105 | A0A022QZR3_ERYGU; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA17957 | 3 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09770.1 | 1e-51 | cell division cycle 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.F01545.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|