PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.F01157.1.p | ||||||||
Common Name | MIMGU_mgv1a013890mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 216aa MW: 24940.6 Da PI: 9.7815 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 94.2 | 6.1e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrngi+KKA+ELSvLCdaeva+i+fs++g+ly +ss Migut.F01157.1.p 9 KRIENATSRQVTFSKRRNGIFKKAYELSVLCDAEVALILFSQKGRLYQFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 73.8 | 4.9e-25 | 81 | 171 | 9 | 99 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 ++++++lq e+a + ++ie L+++qR+llG +L +s++eLq++ +qLe+s+++iR+kK++l++e+ie+l+ kek l een +L++k++ Migut.F01157.1.p 81 EVQQHTQHLQYEAAIMASKIELLENSQRKLLGHNLVVCSIEELQEIDNQLERSINNIRAKKSQLFKEEIEKLRVKEKILLEENARLSEKFQ 171 567889**********************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.4E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.198 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.21E-40 | 3 | 71 | No hit | No description |
SuperFamily | SSF55455 | 1.7E-32 | 3 | 90 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 7.9E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 8.4E-24 | 82 | 170 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.019 | 86 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009838 | Biological Process | abscission | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0080187 | Biological Process | floral organ senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 216 aa Download sequence Send to blast |
MVRGKVEMKR IENATSRQVT FSKRRNGIFK KAYELSVLCD AEVALILFSQ KGRLYQFSSS 60 DMQKTIEKYL QRAKDDNRST EVQQHTQHLQ YEAAIMASKI ELLENSQRKL LGHNLVVCSI 120 EELQEIDNQL ERSINNIRAK KSQLFKEEIE KLRVKEKILL EENARLSEKF QFGFRPKNTA 180 QKQKEITIES HSTTAMESEV VTELFIGLPT SRNAS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
5f28_A | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
6c9l_A | 1e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-20 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00576 | DAP | Transfer from AT5G62165 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.F01157.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012858650.1 | 1e-156 | PREDICTED: MADS-box protein SOC1-like | ||||
Swissprot | Q9FIS1 | 2e-79 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | A0A022PUQ0 | 1e-143 | A0A022PUQ0_ERYGU; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA40 | 24 | 625 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 9e-82 | AGAMOUS-like 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.F01157.1.p |