PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.F00707.1.p
Common NameLOC105977549, MIMGU_mgv1a013156mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family MYB
Protein Properties Length: 230aa    MW: 26199.4 Da    PI: 7.9254
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.F00707.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding271e-082165244
                      SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
   Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                       rWT+eE +++  a +++  +   +W ++a+ ++ g++ +++ + +
  Migut.F00707.1.p 21 TRWTKEENKRFESALAMFDENtpnRWCRVAELIP-GKSVYDVMNQY 65
                      59*****************99*************.*******9987 PP

2Myb_DNA-binding41.53e-13121165347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT++E+ +++ + +++G+g+W++I+r +   +t+ q+ s+ qky
  Migut.F00707.1.p 121 PWTEDEHRRFLLGLQKHGKGDWRSISRNFVISKTPTQVASHAQKY 165
                       8*****************************789***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.7031873IPR017884SANT domain
SMARTSM007179.6E-91971IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-42168IPR009057Homeodomain-like
SuperFamilySSF466891.5E-112176IPR009057Homeodomain-like
PfamPF002493.9E-62165IPR001005SANT/Myb domain
CDDcd001671.09E-62269No hitNo description
Gene3DG3DSA:1.10.10.605.1E-11111171IPR009057Homeodomain-like
PROSITE profilePS5129418.307114170IPR017930Myb domain
SuperFamilySSF466894.64E-16115170IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-18117169IPR006447Myb domain, plants
SMARTSM007171.2E-10118168IPR001005SANT/Myb domain
CDDcd001678.22E-9121165No hitNo description
PfamPF002491.9E-11121165IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
METLCHNSYT PESCWPINGT TRWTKEENKR FESALAMFDE NTPNRWCRVA ELIPGKSVYD  60
VMNQYDELVS DVSDIEAGLV PIPGYLASSF TLELSDHRSF DMYRKRSGIR TCDQERKKGV  120
PWTEDEHRRF LLGLQKHGKG DWRSISRNFV ISKTPTQVAS HAQKYYLRQQ ISGGKDKRRP  180
SIHDITTDNI ADATNVVVVS PSETKKTPPL SEKSNHSLHP CWTGIIVDN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A6e-1523981186RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.F00707.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012858321.11e-173PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012858322.11e-173PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-82DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A022Q0F31e-172A0A022Q0F3_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.12e-81MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]