PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.F00701.1.p
Common NameLOC105977363, MIMGU_mgv1a013900mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WOX
Protein Properties Length: 208aa    MW: 22995.6 Da    PI: 7.9155
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.F00701.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.76.1e-212889157
                      TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                      ++ R+++t+eq+++L elF++  r+ps++++++++++l    +++ ++V++WFqN++a+e++
  Migut.F00701.1.p 28 KCGRWNPTSEQVKVLTELFRSgLRTPSTDQIQKISSQLsfygKIESKNVFYWFQNHKARERQ 89
                      568*****************99**************************************97 PP

2Wus_type_Homeobox114.16.8e-372891265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       ++ RW+Pt+eQ+k+L+el++sGlrtP++++iq+i+++L+ yGkie+kNVfyWFQN+kaRerqk+
   Migut.F00701.1.p 28 KCGRWNPTSEQVKVLTELFRSGLRTPSTDQIQKISSQLSFYGKIESKNVFYWFQNHKARERQKR 91
                       678***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.1432590IPR001356Homeobox domain
SuperFamilySSF466891.03E-112694IPR009057Homeodomain-like
SMARTSM003893.2E-42794IPR001356Homeobox domain
PfamPF000463.4E-182989IPR001356Homeobox domain
CDDcd000861.26E-53191No hitNo description
Gene3DG3DSA:1.10.10.601.7E-83189IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010078Biological Processmaintenance of root meristem identity
GO:1902459Biological Processpositive regulation of stem cell population maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MEDQYSAGFC IRASRGGGCG GGGGGGTKCG RWNPTSEQVK VLTELFRSGL RTPSTDQIQK  60
ISSQLSFYGK IESKNVFYWF QNHKARERQK RRRVLVSTPA ADDDIINIHH HHLQTTTTTN  120
TKLAAVSSTE RNYYGDEGVI NYEVSEGGRV IETLQLFPVK CLIGEAADNN IGNCRENASF  180
ITYGHNNNIN GATEMDHPTL DLRLSFF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18993KRRRV
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.F00701.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012858118.11e-155PREDICTED: WUSCHEL-related homeobox 5
TrEMBLA0A022PW261e-154A0A022PW26_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA122011922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.11e-45WUSCHEL related homeobox 5