PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.D01987.1.p | ||||||||
Common Name | MIMGU_mgv1a019632mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 135aa MW: 14522.2 Da PI: 7.6675 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 84.7 | 1.3e-26 | 2 | 71 | 30 | 99 |
DUF260 30 fanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 fanvhk+FGasnv+kll++l +++reda++sl++eAear+rdPvyG+vg i+ lq+q+++l++el+++++ Migut.D01987.1.p 2 FANVHKIFGASNVSKLLNELLPHQREDAVNSLAFEAEARVRDPVYGCVGAISFLQRQVDRLQKELDAANA 71 99***************************************************************99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 16.813 | 1 | 73 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 7.0E-25 | 2 | 70 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 135 aa Download sequence Send to blast |
MFANVHKIFG ASNVSKLLNE LLPHQREDAV NSLAFEAEAR VRDPVYGCVG AISFLQRQVD 60 RLQKELDAAN ADLIRYAAAA TQAPPPPPRH RSAVDYGRGG GGGGGFYNQT PSSFTFPYNY 120 HFPTWNGGGV DGNI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-41 | 2 | 78 | 40 | 116 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-41 | 2 | 78 | 40 | 116 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.D01987.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012829355.1 | 1e-94 | PREDICTED: protein LATERAL ORGAN BOUNDARIES-like isoform X1 | ||||
Refseq | XP_012829356.1 | 1e-94 | PREDICTED: protein LATERAL ORGAN BOUNDARIES-like isoform X2 | ||||
Swissprot | Q9FML4 | 1e-43 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A022PPS3 | 1e-94 | A0A022PPS3_ERYGU; Uncharacterized protein | ||||
STRING | Migut.D01987.1.p | 2e-95 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA43 | 24 | 669 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 1e-45 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.D01987.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|