PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.D00643.1.p
Common NameLOC105976946, MIMGU_mgv1a006491mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family GRAS
Protein Properties Length: 443aa    MW: 50293.7 Da    PI: 6.3816
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.D00643.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS449.52.2e-137474391374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l++lL++cA++vs+g++e+a+ +L ++s+lasp+gd+mqR+a+yf eALa r++r+++++yka+++++ s    see+ ++k+fs+  P+ k+
  Migut.D00643.1.p  47 LIHLLVTCANHVSQGSFENANIALDQISHLASPNGDTMQRIASYFSEALADRILRTWPGIYKAFRSTKIS--FLSEEILVRKMFSDFLPFTKV 137
                       689*************************************************************999887..69******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrl 186
                       + ++aNqaI ea+ege++vH iD+++  ++QW aL+q L +Rpegpp+lRiTg+++    +ke l ++++ L++ Ae+l++pf+fn+ ++ +l
  Migut.D00643.1.p 138 ASVIANQAIIEAMEGEKMVHLIDLNAADPTQWRALIQDLRARPEGPPHLRITGIHH----RKEVLDHMARILTQEAEKLDLPFQFNP-IVCKL 225
                       ********************************************************....9**************************.5788* PP

              GRAS 187 edleleeLrvkpgEalaVnlvlqlhrll..........................desvsleserdevLklvkslsPkvvvvveqeadhnsesF 253
                       e+le+e+Lrvk+gEala+++  qlh+ll                          + ++s++ ++d++++ +++lsPk++vv+eq++dhn++ +
  Migut.D00643.1.p 226 ENLEFENLRVKTGEALAISSFTQLHTLLapnndprngshlqremldkdnesgssSPPLSSSARIDSFISGLWGLSPKIMVVTEQDSDHNGKGL 318
                       ************************************************9999655555555599***************************** PP

              GRAS 254 lerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvks 346
                       +er++ al++y+alfd+le++lpres er k+E+++lg+ei+n++aceg er+erhe+lekW++r+e +GF +vpls++a+ qak+l++ ++ 
  Migut.D00643.1.p 319 MERLSGALYFYAALFDCLESSLPRESLERLKMEKMVLGEEIKNIIACEGVERKERHEKLEKWSQRFEFCGFANVPLSYYAMLQAKRLMQGFNC 411
                       ********************************************************************************************* PP

              GRAS 347 dgyrveeesgslvlgWkdrpLvsvSaWr 374
                       +gy++++e+g++v++W+drpL+svSaWr
  Migut.D00643.1.p 412 EGYNIKDENGCVVICWQDRPLFSVSAWR 439
                       ***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.02521419IPR005202Transcription factor GRAS
PfamPF035147.5E-13547439IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MFQEEGSSSV TSSPLQMFPM MSLPPSLTMS PYPWLKDLKP EERGLYLIHL LVTCANHVSQ  60
GSFENANIAL DQISHLASPN GDTMQRIASY FSEALADRIL RTWPGIYKAF RSTKISFLSE  120
EILVRKMFSD FLPFTKVASV IANQAIIEAM EGEKMVHLID LNAADPTQWR ALIQDLRARP  180
EGPPHLRITG IHHRKEVLDH MARILTQEAE KLDLPFQFNP IVCKLENLEF ENLRVKTGEA  240
LAISSFTQLH TLLAPNNDPR NGSHLQREML DKDNESGSSS PPLSSSARID SFISGLWGLS  300
PKIMVVTEQD SDHNGKGLME RLSGALYFYA ALFDCLESSL PRESLERLKM EKMVLGEEIK  360
NIIACEGVER KERHEKLEKW SQRFEFCGFA NVPLSYYAML QAKRLMQGFN CEGYNIKDEN  420
GCVVICWQDR PLFSVSAWRY RR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A5e-70304411380Protein SCARECROW
5b3h_D5e-70304411380Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.D00643.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012857698.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A022S4E40.0A0A022S4E4_ERYGU; Uncharacterized protein
STRINGMigut.D00643.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]