PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.C00785.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 135aa MW: 15048.9 Da PI: 9.5906 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89.9 | 1.3e-28 | 9 | 56 | 1 | 48 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48 k+ien++nrqvt+skRrng++KKA+ELSvLCda+v+++++sst+kl++ Migut.C00785.1.p 9 KKIENQTNRQVTYSKRRNGLFKKAHELSVLCDAKVSIVMISSTQKLHD 56 78********************************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.1E-36 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.83E-27 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.787 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.36E-36 | 2 | 64 | No hit | No description |
PRINTS | PR00404 | 3.0E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.1E-24 | 10 | 55 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.0E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.0E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 135 aa Download sequence Send to blast |
MARGKIQIKK IENQTNRQVT YSKRRNGLFK KAHELSVLCD AKVSIVMISS TQKLHDTSAP 60 PSQDPHYGLV ENEGDYNSVL GFPHGGPRII ALRLPPNHHQ HQHHHHEQQH HQHHHPGLHS 120 GGAGSDLTTF ALLE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 3e-16 | 1 | 55 | 1 | 55 | MEF2C |
5f28_B | 3e-16 | 1 | 55 | 1 | 55 | MEF2C |
5f28_C | 3e-16 | 1 | 55 | 1 | 55 | MEF2C |
5f28_D | 3e-16 | 1 | 55 | 1 | 55 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the genetic control of flower development. Acts in conjunction with GLOBOSA (glo). |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.C00785.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY524012 | 1e-118 | AY524012.1 Mimulus guttatus deficiens (DEF) mRNA, DEFA paralog, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012842816.1 | 2e-46 | PREDICTED: floral homeotic protein DEFICIENS-like | ||||
Swissprot | P23706 | 7e-32 | DEFA_ANTMA; Floral homeotic protein DEFICIENS | ||||
TrEMBL | A0A2G2ZSE8 | 5e-48 | A0A2G2ZSE8_CAPAN; Floral homeotic protein PMADS 1 |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2314 | 24 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54340.1 | 2e-31 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.C00785.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|